Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4SA47

Protein Details
Accession F4SA47    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-36EKKSGKLMFKGEKKEKKHKKRRHQEINESNNTPQBasic
NLS Segment(s)
PositionSequence
4-24KKSGKLMFKGEKKEKKHKKRR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR008999  Actin-crosslinking  
IPR010414  FRG1  
Gene Ontology GO:0005730  C:nucleolus  
KEGG mlr:MELLADRAFT_76080  -  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences MGEKKSGKLMFKGEKKEKKHKKRRHQEINESNNTPQDQTEGWLNPPTPNHILGPIYSICINPPKSKPCSIAIFPSPVTPIAKVAPAILSTEALETLEPDDVNHVMVCTRIVDSETMVTLRVANGRYLATDELGDVTAEREARGIQEEWTFEPIILPNEDEKLNEEPSTSNQKNEESIQVEKGETLDGVFSIRSIAYNKYISIEEIAGGKLSIRCDSTTSDDPSCQFLVRMQAAELIKAKKRLADELAKKGLLAQSNDNGTNLGLTILKPGQTIADLEANAIRQSQTRGAGRLITSMESSSSLKKARKDGRLAEELLDRRSKLKSDRYAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.84
4 0.86
5 0.88
6 0.91
7 0.91
8 0.92
9 0.94
10 0.96
11 0.96
12 0.96
13 0.96
14 0.95
15 0.95
16 0.92
17 0.84
18 0.74
19 0.67
20 0.58
21 0.47
22 0.36
23 0.29
24 0.21
25 0.19
26 0.24
27 0.21
28 0.22
29 0.26
30 0.26
31 0.27
32 0.27
33 0.31
34 0.28
35 0.28
36 0.27
37 0.25
38 0.25
39 0.22
40 0.25
41 0.19
42 0.18
43 0.17
44 0.16
45 0.15
46 0.21
47 0.24
48 0.26
49 0.32
50 0.38
51 0.43
52 0.48
53 0.49
54 0.48
55 0.51
56 0.48
57 0.48
58 0.44
59 0.42
60 0.37
61 0.35
62 0.31
63 0.26
64 0.24
65 0.18
66 0.17
67 0.14
68 0.15
69 0.14
70 0.13
71 0.12
72 0.11
73 0.12
74 0.11
75 0.1
76 0.09
77 0.09
78 0.08
79 0.07
80 0.07
81 0.06
82 0.06
83 0.07
84 0.07
85 0.06
86 0.08
87 0.08
88 0.09
89 0.08
90 0.07
91 0.06
92 0.06
93 0.07
94 0.06
95 0.06
96 0.06
97 0.07
98 0.07
99 0.08
100 0.08
101 0.08
102 0.08
103 0.08
104 0.07
105 0.07
106 0.07
107 0.1
108 0.1
109 0.09
110 0.1
111 0.1
112 0.1
113 0.12
114 0.11
115 0.09
116 0.08
117 0.08
118 0.07
119 0.07
120 0.07
121 0.05
122 0.05
123 0.06
124 0.06
125 0.06
126 0.06
127 0.05
128 0.06
129 0.09
130 0.09
131 0.09
132 0.11
133 0.12
134 0.12
135 0.14
136 0.14
137 0.11
138 0.11
139 0.11
140 0.1
141 0.1
142 0.09
143 0.08
144 0.09
145 0.1
146 0.09
147 0.11
148 0.12
149 0.13
150 0.12
151 0.12
152 0.11
153 0.14
154 0.24
155 0.21
156 0.21
157 0.21
158 0.22
159 0.23
160 0.24
161 0.24
162 0.17
163 0.18
164 0.18
165 0.17
166 0.16
167 0.15
168 0.14
169 0.1
170 0.07
171 0.06
172 0.05
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.05
180 0.07
181 0.08
182 0.11
183 0.12
184 0.13
185 0.14
186 0.14
187 0.14
188 0.13
189 0.12
190 0.09
191 0.09
192 0.09
193 0.07
194 0.07
195 0.08
196 0.08
197 0.09
198 0.09
199 0.1
200 0.1
201 0.12
202 0.15
203 0.2
204 0.23
205 0.26
206 0.26
207 0.26
208 0.27
209 0.28
210 0.26
211 0.2
212 0.16
213 0.13
214 0.18
215 0.18
216 0.17
217 0.15
218 0.19
219 0.19
220 0.21
221 0.24
222 0.22
223 0.24
224 0.27
225 0.28
226 0.26
227 0.27
228 0.3
229 0.32
230 0.38
231 0.41
232 0.45
233 0.49
234 0.46
235 0.44
236 0.41
237 0.38
238 0.33
239 0.28
240 0.24
241 0.24
242 0.27
243 0.28
244 0.26
245 0.23
246 0.19
247 0.16
248 0.13
249 0.1
250 0.07
251 0.06
252 0.1
253 0.11
254 0.12
255 0.12
256 0.12
257 0.11
258 0.12
259 0.13
260 0.11
261 0.14
262 0.13
263 0.14
264 0.15
265 0.15
266 0.15
267 0.15
268 0.13
269 0.11
270 0.15
271 0.18
272 0.23
273 0.26
274 0.28
275 0.29
276 0.32
277 0.3
278 0.3
279 0.27
280 0.22
281 0.2
282 0.18
283 0.17
284 0.16
285 0.18
286 0.18
287 0.21
288 0.26
289 0.3
290 0.35
291 0.45
292 0.51
293 0.58
294 0.64
295 0.68
296 0.7
297 0.71
298 0.67
299 0.6
300 0.59
301 0.53
302 0.49
303 0.45
304 0.37
305 0.34
306 0.36
307 0.38
308 0.39
309 0.46