Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9ACM1

Protein Details
Accession R9ACM1    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
152-172VKEFKQMRKLYHKRNIWADKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, cyto 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037202  ESCRT_assembly_dom  
IPR029012  Helix_hairpin_bin_sf  
IPR009851  Mod_r  
Gene Ontology GO:0000813  C:ESCRT I complex  
GO:0072666  P:establishment of protein localization to vacuole  
GO:0006886  P:intracellular protein transport  
GO:0043162  P:ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway  
GO:0007034  P:vacuolar transport  
KEGG wic:J056_001429  -  
Pfam View protein in Pfam  
PF07200  Mod_r  
PROSITE View protein in PROSITE  
PS51314  VPS37_C  
Amino Acid Sequences MTLLFQEFPELESLSRQDLEELLQSPSYLDAVYSTLPRTEALKKREELLMLSNEDLAKRNMELGETLMALRRDTQHSYDEATAAYTRWNEIEKQLKDIDHKTSTAFLTMRLKQAVSQQDDLSETIASDFISSANMDEYSDPKEQQQHIDTFVKEFKQMRKLYHKRNIWADKASHGDVIWQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.17
4 0.15
5 0.14
6 0.16
7 0.16
8 0.16
9 0.15
10 0.14
11 0.14
12 0.14
13 0.14
14 0.12
15 0.09
16 0.07
17 0.06
18 0.07
19 0.09
20 0.1
21 0.1
22 0.1
23 0.11
24 0.12
25 0.14
26 0.22
27 0.29
28 0.32
29 0.38
30 0.38
31 0.4
32 0.42
33 0.39
34 0.32
35 0.29
36 0.28
37 0.22
38 0.22
39 0.21
40 0.18
41 0.18
42 0.18
43 0.14
44 0.11
45 0.1
46 0.11
47 0.1
48 0.1
49 0.1
50 0.09
51 0.09
52 0.09
53 0.09
54 0.1
55 0.1
56 0.09
57 0.1
58 0.12
59 0.14
60 0.16
61 0.18
62 0.17
63 0.18
64 0.2
65 0.19
66 0.17
67 0.14
68 0.13
69 0.11
70 0.09
71 0.09
72 0.07
73 0.07
74 0.07
75 0.08
76 0.08
77 0.12
78 0.21
79 0.2
80 0.23
81 0.24
82 0.25
83 0.27
84 0.29
85 0.3
86 0.22
87 0.22
88 0.2
89 0.2
90 0.19
91 0.19
92 0.16
93 0.14
94 0.19
95 0.2
96 0.22
97 0.21
98 0.21
99 0.2
100 0.26
101 0.3
102 0.28
103 0.28
104 0.26
105 0.26
106 0.27
107 0.26
108 0.2
109 0.13
110 0.09
111 0.07
112 0.07
113 0.06
114 0.05
115 0.05
116 0.04
117 0.05
118 0.05
119 0.05
120 0.06
121 0.07
122 0.07
123 0.08
124 0.09
125 0.13
126 0.15
127 0.15
128 0.17
129 0.23
130 0.24
131 0.3
132 0.33
133 0.31
134 0.34
135 0.38
136 0.36
137 0.33
138 0.35
139 0.31
140 0.3
141 0.34
142 0.35
143 0.4
144 0.43
145 0.48
146 0.56
147 0.64
148 0.7
149 0.75
150 0.76
151 0.74
152 0.81
153 0.81
154 0.76
155 0.73
156 0.64
157 0.6
158 0.58
159 0.52
160 0.42