Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9A969

Protein Details
Accession R9A969   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
122-147YSSIPAYKAHKKTHKKNQGCSRHLIRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto_nucl 8.5, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR016137  RGS  
IPR036305  RGS_sf  
IPR044926  RGS_subdomain_2  
KEGG wic:J056_002863  -  
Pfam View protein in Pfam  
PF00615  RGS  
Amino Acid Sequences MSTPTTEQIGTMRGTLGVIMGDGKGRRKFCFYLREQERSMENLEFVMWFEDHYHRSSHILPHEASSSLRKYFARKSAHELNLDANVKVNVVDTAHMLIKQHLPTPLCIFQPAYLTCCSLLEYSSIPAYKAHKKTHKKNQGCSRHLIRSIREVFSKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.09
4 0.06
5 0.06
6 0.06
7 0.05
8 0.09
9 0.11
10 0.17
11 0.23
12 0.25
13 0.27
14 0.32
15 0.36
16 0.39
17 0.48
18 0.46
19 0.51
20 0.56
21 0.59
22 0.55
23 0.54
24 0.5
25 0.42
26 0.4
27 0.3
28 0.23
29 0.17
30 0.16
31 0.13
32 0.11
33 0.1
34 0.07
35 0.07
36 0.09
37 0.12
38 0.13
39 0.14
40 0.15
41 0.14
42 0.17
43 0.18
44 0.21
45 0.21
46 0.23
47 0.22
48 0.23
49 0.23
50 0.21
51 0.2
52 0.19
53 0.18
54 0.15
55 0.17
56 0.17
57 0.19
58 0.24
59 0.31
60 0.34
61 0.33
62 0.39
63 0.45
64 0.48
65 0.45
66 0.41
67 0.34
68 0.34
69 0.33
70 0.26
71 0.17
72 0.14
73 0.13
74 0.12
75 0.11
76 0.06
77 0.05
78 0.06
79 0.05
80 0.07
81 0.07
82 0.08
83 0.08
84 0.09
85 0.12
86 0.13
87 0.15
88 0.17
89 0.17
90 0.19
91 0.24
92 0.25
93 0.22
94 0.22
95 0.21
96 0.19
97 0.23
98 0.22
99 0.19
100 0.17
101 0.17
102 0.16
103 0.16
104 0.16
105 0.11
106 0.11
107 0.1
108 0.1
109 0.11
110 0.14
111 0.14
112 0.13
113 0.15
114 0.2
115 0.28
116 0.35
117 0.43
118 0.5
119 0.6
120 0.71
121 0.79
122 0.85
123 0.84
124 0.88
125 0.89
126 0.9
127 0.84
128 0.82
129 0.79
130 0.76
131 0.75
132 0.7
133 0.63
134 0.62
135 0.63
136 0.58
137 0.57