Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R9AEU3

Protein Details
Accession R9AEU3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
38-57LSPDLKRKVDHNRKEREKMEBasic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012420  Cbp4  
Gene Ontology GO:0016020  C:membrane  
KEGG wic:J056_000465  -  
Pfam View protein in Pfam  
PF07960  CBP4  
Amino Acid Sequences MVKIAWGRWAFWSSVIMGSGYGLMVGLTPSDEELYNKLSPDLKRKVDHNRKEREKMEAMSAKERAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.12
4 0.1
5 0.09
6 0.08
7 0.07
8 0.05
9 0.04
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.03
16 0.03
17 0.04
18 0.04
19 0.05
20 0.06
21 0.1
22 0.1
23 0.1
24 0.11
25 0.15
26 0.17
27 0.25
28 0.32
29 0.33
30 0.36
31 0.42
32 0.52
33 0.58
34 0.66
35 0.67
36 0.71
37 0.75
38 0.81
39 0.77
40 0.74
41 0.69
42 0.61
43 0.61
44 0.56
45 0.51
46 0.5