Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R8A2

Protein Details
Accession F4R8A2    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTNQKKVKLKKPENLKRKPQNELDARCHydrophilic
NLS Segment(s)
PositionSequence
6-18KVKLKKPENLKRK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, cyto 4.5, mito 4
Family & Domain DBs
KEGG mlr:MELLADRAFT_90989  -  
Amino Acid Sequences MTNQKKVKLKKPENLKRKPQNELDARCLAMKRRRRVHAEITVGQAVSNAAEQYDRADRLVPGGSGDIIIPMAKHPAFDESDRDEEPDPLGQLPPSPPPHDANITGEVFAFGLNEGFHAGRRQREEEDWRNRYPAMFPVFLACQQRTNNWSNVDTRFKDWKGPCNCTGTIRTFDVLDLTYKVEDVSMFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.89
4 0.86
5 0.86
6 0.82
7 0.82
8 0.81
9 0.76
10 0.72
11 0.64
12 0.59
13 0.53
14 0.47
15 0.45
16 0.44
17 0.47
18 0.5
19 0.56
20 0.63
21 0.68
22 0.73
23 0.74
24 0.74
25 0.72
26 0.65
27 0.6
28 0.54
29 0.46
30 0.39
31 0.3
32 0.2
33 0.13
34 0.11
35 0.06
36 0.05
37 0.05
38 0.05
39 0.08
40 0.12
41 0.12
42 0.12
43 0.13
44 0.13
45 0.15
46 0.16
47 0.13
48 0.1
49 0.1
50 0.09
51 0.08
52 0.08
53 0.06
54 0.05
55 0.05
56 0.04
57 0.04
58 0.07
59 0.07
60 0.07
61 0.08
62 0.1
63 0.12
64 0.13
65 0.16
66 0.17
67 0.2
68 0.2
69 0.21
70 0.19
71 0.17
72 0.17
73 0.14
74 0.11
75 0.09
76 0.09
77 0.07
78 0.08
79 0.08
80 0.12
81 0.14
82 0.15
83 0.17
84 0.18
85 0.21
86 0.22
87 0.22
88 0.2
89 0.21
90 0.2
91 0.18
92 0.16
93 0.14
94 0.11
95 0.1
96 0.07
97 0.04
98 0.04
99 0.03
100 0.04
101 0.05
102 0.05
103 0.06
104 0.09
105 0.12
106 0.16
107 0.2
108 0.22
109 0.24
110 0.3
111 0.38
112 0.45
113 0.53
114 0.54
115 0.52
116 0.51
117 0.48
118 0.44
119 0.36
120 0.33
121 0.27
122 0.22
123 0.21
124 0.22
125 0.23
126 0.25
127 0.28
128 0.22
129 0.22
130 0.23
131 0.27
132 0.3
133 0.33
134 0.34
135 0.34
136 0.35
137 0.34
138 0.39
139 0.44
140 0.41
141 0.42
142 0.45
143 0.43
144 0.49
145 0.49
146 0.53
147 0.53
148 0.57
149 0.56
150 0.54
151 0.54
152 0.5
153 0.51
154 0.46
155 0.43
156 0.38
157 0.35
158 0.3
159 0.28
160 0.26
161 0.21
162 0.18
163 0.15
164 0.15
165 0.14
166 0.13
167 0.13
168 0.12