Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9AHW9

Protein Details
Accession R9AHW9   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-27SKKAQRYAIKARQRIQRRARETDQKEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003959  ATPase_AAA_core  
IPR001270  ClpA/B  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
KEGG wic:J056_004004  -  
Pfam View protein in Pfam  
PF07724  AAA_2  
Amino Acid Sequences MSKKAQRYAIKARQRIQRRARETDQKELERAYNDWEFHKNLLENKSIERTIGQARIDTSANAVQMSPAGLQSDNRSVASSLFLGPKSTCKTELSRKLSGALLNDQKQALININMSEYQEKHTVSPLVGATPRYVGYEESGQLSEVMRRRPYSVVLLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.81
4 0.82
5 0.79
6 0.8
7 0.81
8 0.82
9 0.78
10 0.78
11 0.76
12 0.69
13 0.63
14 0.56
15 0.51
16 0.42
17 0.38
18 0.33
19 0.29
20 0.27
21 0.28
22 0.29
23 0.28
24 0.26
25 0.29
26 0.26
27 0.26
28 0.29
29 0.3
30 0.27
31 0.28
32 0.32
33 0.28
34 0.26
35 0.21
36 0.2
37 0.2
38 0.23
39 0.21
40 0.18
41 0.18
42 0.2
43 0.2
44 0.17
45 0.15
46 0.13
47 0.12
48 0.11
49 0.1
50 0.08
51 0.08
52 0.08
53 0.06
54 0.05
55 0.05
56 0.05
57 0.06
58 0.08
59 0.11
60 0.11
61 0.11
62 0.12
63 0.11
64 0.11
65 0.12
66 0.1
67 0.09
68 0.09
69 0.09
70 0.1
71 0.1
72 0.13
73 0.16
74 0.16
75 0.17
76 0.18
77 0.23
78 0.31
79 0.41
80 0.44
81 0.43
82 0.42
83 0.43
84 0.42
85 0.38
86 0.31
87 0.27
88 0.27
89 0.26
90 0.27
91 0.25
92 0.23
93 0.22
94 0.21
95 0.17
96 0.13
97 0.12
98 0.11
99 0.12
100 0.13
101 0.13
102 0.15
103 0.13
104 0.15
105 0.17
106 0.18
107 0.17
108 0.2
109 0.2
110 0.18
111 0.21
112 0.18
113 0.17
114 0.18
115 0.19
116 0.16
117 0.16
118 0.17
119 0.15
120 0.15
121 0.13
122 0.15
123 0.17
124 0.17
125 0.18
126 0.18
127 0.17
128 0.17
129 0.17
130 0.19
131 0.21
132 0.26
133 0.29
134 0.3
135 0.33
136 0.35
137 0.37