Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9AAS9

Protein Details
Accession R9AAS9   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
147-168INCKNIRKTAKRYKNRVVKNTGHydrophilic
236-257HMGNKVKKPVKKIKNAFTRDVFHydrophilic
NLS Segment(s)
PositionSequence
239-248NKVKKPVKKI
Subcellular Location(s) mito 9, cyto 8.5, cyto_nucl 8.5, nucl 7.5
Family & Domain DBs
KEGG wic:J056_001879  -  
Amino Acid Sequences MNEISRSPTPANKNGLSGSFSSYVSTNATTIGNSSGYNINSIGIDVFEDTDSDEEFDSAHLSAASDAISDVNPNTISIPAPTVTQQINPKLMHVINKLGIDVNEISSAQSYNDLNTIANQYIERNDFIINKCEIFLEELNIEVSGIINCKNIRKTAKRYKNRVVKNTGKLQYYQIRFGEISGFSVEENVKLIEAFSNISFKGDSKLKKSYVHRWAVILSESRDDTLGTRHPKRDIHMGNKVKKPVKKIKNAFTRDVFIDCRFHKPVEIERIFLNAQGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.39
4 0.33
5 0.31
6 0.25
7 0.24
8 0.22
9 0.2
10 0.19
11 0.18
12 0.18
13 0.13
14 0.13
15 0.13
16 0.12
17 0.12
18 0.13
19 0.12
20 0.11
21 0.13
22 0.16
23 0.15
24 0.17
25 0.16
26 0.14
27 0.13
28 0.14
29 0.11
30 0.07
31 0.07
32 0.06
33 0.07
34 0.06
35 0.06
36 0.07
37 0.07
38 0.08
39 0.08
40 0.08
41 0.07
42 0.07
43 0.07
44 0.08
45 0.07
46 0.07
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.06
58 0.07
59 0.07
60 0.07
61 0.08
62 0.08
63 0.09
64 0.09
65 0.1
66 0.09
67 0.09
68 0.1
69 0.12
70 0.12
71 0.17
72 0.21
73 0.23
74 0.28
75 0.27
76 0.27
77 0.28
78 0.28
79 0.29
80 0.26
81 0.25
82 0.22
83 0.23
84 0.22
85 0.19
86 0.18
87 0.15
88 0.14
89 0.12
90 0.09
91 0.09
92 0.09
93 0.09
94 0.09
95 0.06
96 0.08
97 0.07
98 0.07
99 0.08
100 0.08
101 0.08
102 0.09
103 0.1
104 0.08
105 0.09
106 0.09
107 0.08
108 0.1
109 0.11
110 0.11
111 0.1
112 0.11
113 0.13
114 0.14
115 0.18
116 0.16
117 0.15
118 0.15
119 0.14
120 0.13
121 0.13
122 0.12
123 0.09
124 0.08
125 0.08
126 0.08
127 0.08
128 0.07
129 0.05
130 0.05
131 0.04
132 0.04
133 0.05
134 0.06
135 0.07
136 0.1
137 0.12
138 0.16
139 0.23
140 0.3
141 0.4
142 0.49
143 0.59
144 0.66
145 0.73
146 0.79
147 0.81
148 0.82
149 0.8
150 0.78
151 0.76
152 0.73
153 0.74
154 0.68
155 0.6
156 0.53
157 0.51
158 0.5
159 0.43
160 0.41
161 0.32
162 0.3
163 0.28
164 0.27
165 0.25
166 0.17
167 0.16
168 0.12
169 0.12
170 0.09
171 0.11
172 0.11
173 0.08
174 0.09
175 0.07
176 0.07
177 0.07
178 0.07
179 0.06
180 0.07
181 0.08
182 0.07
183 0.09
184 0.09
185 0.1
186 0.1
187 0.1
188 0.14
189 0.19
190 0.22
191 0.26
192 0.33
193 0.35
194 0.43
195 0.49
196 0.54
197 0.58
198 0.61
199 0.57
200 0.52
201 0.49
202 0.43
203 0.4
204 0.34
205 0.25
206 0.21
207 0.2
208 0.19
209 0.18
210 0.17
211 0.15
212 0.16
213 0.22
214 0.27
215 0.33
216 0.36
217 0.41
218 0.44
219 0.47
220 0.54
221 0.55
222 0.55
223 0.6
224 0.66
225 0.69
226 0.73
227 0.77
228 0.74
229 0.7
230 0.71
231 0.71
232 0.72
233 0.74
234 0.77
235 0.78
236 0.82
237 0.84
238 0.81
239 0.75
240 0.69
241 0.6
242 0.55
243 0.49
244 0.41
245 0.42
246 0.37
247 0.4
248 0.38
249 0.37
250 0.37
251 0.38
252 0.44
253 0.48
254 0.48
255 0.42
256 0.4
257 0.43
258 0.39