Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S409

Protein Details
Accession F4S409    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAKSLRSKSKRSFRAKKRSSNDSVFKHydrophilic
NLS Segment(s)
PositionSequence
6-18RSKSKRSFRAKKR
114-124KRQPGKPLRRR
Subcellular Location(s) nucl 20, mito_nucl 13.833, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG mlr:MELLADRAFT_111684  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKSKRSFRAKKRSSNDSVFKIADTNRTNRLSEKLKESASKPIQSTTTNESNSMEIEKDVEAETEEGTKEGEKVKVATSGHRMSGREVWKSNTKGVLLKRSPSTVFWGKRQPGKPLRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.91
4 0.87
5 0.87
6 0.84
7 0.82
8 0.79
9 0.72
10 0.68
11 0.58
12 0.5
13 0.44
14 0.37
15 0.36
16 0.32
17 0.31
18 0.33
19 0.35
20 0.36
21 0.34
22 0.39
23 0.37
24 0.37
25 0.4
26 0.37
27 0.37
28 0.39
29 0.39
30 0.42
31 0.41
32 0.41
33 0.36
34 0.34
35 0.34
36 0.32
37 0.33
38 0.29
39 0.3
40 0.27
41 0.26
42 0.25
43 0.23
44 0.22
45 0.19
46 0.14
47 0.07
48 0.08
49 0.07
50 0.07
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.05
59 0.06
60 0.06
61 0.06
62 0.08
63 0.09
64 0.09
65 0.1
66 0.11
67 0.16
68 0.16
69 0.19
70 0.23
71 0.24
72 0.26
73 0.28
74 0.28
75 0.27
76 0.34
77 0.34
78 0.33
79 0.33
80 0.35
81 0.4
82 0.42
83 0.42
84 0.38
85 0.36
86 0.36
87 0.4
88 0.46
89 0.41
90 0.43
91 0.43
92 0.44
93 0.44
94 0.4
95 0.42
96 0.41
97 0.43
98 0.44
99 0.51
100 0.53
101 0.61
102 0.64
103 0.66
104 0.67