Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9A9Q9

Protein Details
Accession R9A9Q9    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MVSQIKPKIVKKTKGSFNRFQSDRHydrophilic
NLS Segment(s)
PositionSequence
33-37RRPKG
43-44RR
Subcellular Location(s) mito 11.5mito_nucl 11.5, nucl 10.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG wic:J056_002625  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSQIKPKIVKKTKGSFNRFQSDRFHRVAPSWRRPKGIDNAMRRRFKGQPTMPKIGFGSNKVTRHLRPNGLKTVVVNNVKDVDLLLMHTSKFTAEIAHNVSSKKRVEILARAKALNVKVTNAAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.81
4 0.8
5 0.81
6 0.73
7 0.66
8 0.65
9 0.63
10 0.61
11 0.55
12 0.48
13 0.4
14 0.42
15 0.5
16 0.5
17 0.53
18 0.56
19 0.57
20 0.59
21 0.6
22 0.62
23 0.61
24 0.61
25 0.58
26 0.59
27 0.66
28 0.71
29 0.72
30 0.67
31 0.63
32 0.58
33 0.55
34 0.55
35 0.52
36 0.54
37 0.57
38 0.63
39 0.58
40 0.54
41 0.5
42 0.44
43 0.38
44 0.29
45 0.29
46 0.28
47 0.29
48 0.3
49 0.32
50 0.3
51 0.35
52 0.38
53 0.38
54 0.37
55 0.4
56 0.43
57 0.41
58 0.4
59 0.34
60 0.33
61 0.33
62 0.3
63 0.26
64 0.21
65 0.21
66 0.21
67 0.2
68 0.15
69 0.09
70 0.07
71 0.07
72 0.08
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.08
81 0.08
82 0.12
83 0.16
84 0.19
85 0.21
86 0.21
87 0.23
88 0.26
89 0.27
90 0.25
91 0.24
92 0.25
93 0.28
94 0.37
95 0.44
96 0.47
97 0.48
98 0.47
99 0.45
100 0.46
101 0.43
102 0.41
103 0.33
104 0.26
105 0.27
106 0.29
107 0.3
108 0.27
109 0.29
110 0.24