Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9AID3

Protein Details
Accession R9AID3    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
48-74TPTKTPTKTPTKTPNRRGNRRQPQSVPHydrophilic
124-147PSSSTTPRKKTKGKQRTKSASDGIHydrophilic
161-181TNTPNKPYNRRPHTDNPNTNTHydrophilic
NLS Segment(s)
PositionSequence
131-138RKKTKGKQ
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
KEGG wic:J056_003551  -  
Pfam View protein in Pfam  
PF15365  PNRC  
Amino Acid Sequences MSQHRKSNRQKLISEIEDEEEGSVQVGGLKAERDGEGVAGTRTQTTQTPTKTPTKTPTKTPNRRGNRRQPQSVPAKSSQINWDMPVNNQQQRRNEPYNWQEVLQTLPGAGAGVSGVSAAPPTAPSSSTTPRKKTKGKQRTKSASDGISGLNWQQIQLTRSTNTPNKPYNRRPHTDNPNTNTNTNPYAGAAFHNSPAPDELPAPKFLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.52
3 0.44
4 0.36
5 0.34
6 0.27
7 0.18
8 0.14
9 0.11
10 0.08
11 0.06
12 0.07
13 0.07
14 0.07
15 0.07
16 0.08
17 0.08
18 0.1
19 0.1
20 0.09
21 0.09
22 0.09
23 0.09
24 0.1
25 0.1
26 0.09
27 0.09
28 0.09
29 0.09
30 0.1
31 0.12
32 0.16
33 0.22
34 0.25
35 0.29
36 0.34
37 0.42
38 0.44
39 0.46
40 0.51
41 0.54
42 0.54
43 0.58
44 0.64
45 0.66
46 0.74
47 0.79
48 0.8
49 0.81
50 0.88
51 0.89
52 0.9
53 0.9
54 0.88
55 0.86
56 0.79
57 0.77
58 0.77
59 0.71
60 0.65
61 0.56
62 0.52
63 0.45
64 0.43
65 0.38
66 0.32
67 0.28
68 0.24
69 0.25
70 0.22
71 0.22
72 0.27
73 0.28
74 0.29
75 0.34
76 0.37
77 0.39
78 0.44
79 0.51
80 0.48
81 0.44
82 0.47
83 0.46
84 0.48
85 0.43
86 0.38
87 0.31
88 0.26
89 0.25
90 0.18
91 0.14
92 0.07
93 0.06
94 0.05
95 0.05
96 0.04
97 0.03
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.03
108 0.04
109 0.05
110 0.06
111 0.08
112 0.13
113 0.2
114 0.3
115 0.36
116 0.42
117 0.49
118 0.56
119 0.63
120 0.68
121 0.72
122 0.74
123 0.79
124 0.82
125 0.85
126 0.88
127 0.84
128 0.8
129 0.73
130 0.63
131 0.53
132 0.45
133 0.34
134 0.25
135 0.2
136 0.14
137 0.13
138 0.11
139 0.1
140 0.1
141 0.13
142 0.14
143 0.16
144 0.19
145 0.17
146 0.2
147 0.27
148 0.31
149 0.34
150 0.4
151 0.45
152 0.51
153 0.6
154 0.68
155 0.72
156 0.74
157 0.74
158 0.75
159 0.77
160 0.8
161 0.81
162 0.8
163 0.74
164 0.75
165 0.73
166 0.67
167 0.59
168 0.52
169 0.44
170 0.35
171 0.31
172 0.22
173 0.19
174 0.19
175 0.19
176 0.2
177 0.18
178 0.19
179 0.21
180 0.21
181 0.21
182 0.23
183 0.22
184 0.18
185 0.19
186 0.24
187 0.24