Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RNE3

Protein Details
Accession F4RNE3    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23SKIAHYQKKRKFKLGRQTVMTKLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto_nucl 2, nucl 1.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR042563  Ribosomal_protein_S8e_euk  
IPR001047  Ribosomal_S8e  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mlr:MELLADRAFT_36395  -  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
CDD cd11380  Ribosomal_S8e_like  
Amino Acid Sequences SKIAHYQKKRKFKLGRQTVMTKLGAKSIHTVRVRGGNIKHRALRIKSGNFAWGSECVTKKTQVIGVVYNSTNNELVRTNTFVKGAIIQIDATPFRQWYEAHYGQPVTKKGKASLSHAPKEKSKAVLKKLEQQKATAKIDHTLETQFQAGHLYTSISSGPGQSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.81
4 0.8
5 0.74
6 0.7
7 0.62
8 0.54
9 0.43
10 0.4
11 0.33
12 0.28
13 0.3
14 0.28
15 0.35
16 0.33
17 0.33
18 0.31
19 0.37
20 0.38
21 0.38
22 0.4
23 0.41
24 0.46
25 0.51
26 0.52
27 0.49
28 0.54
29 0.51
30 0.54
31 0.53
32 0.5
33 0.48
34 0.45
35 0.45
36 0.37
37 0.35
38 0.28
39 0.21
40 0.2
41 0.2
42 0.2
43 0.18
44 0.2
45 0.21
46 0.2
47 0.2
48 0.2
49 0.19
50 0.19
51 0.18
52 0.18
53 0.19
54 0.19
55 0.18
56 0.16
57 0.14
58 0.13
59 0.11
60 0.11
61 0.09
62 0.11
63 0.11
64 0.14
65 0.15
66 0.14
67 0.15
68 0.14
69 0.13
70 0.13
71 0.11
72 0.09
73 0.08
74 0.07
75 0.07
76 0.08
77 0.08
78 0.08
79 0.08
80 0.07
81 0.08
82 0.09
83 0.09
84 0.12
85 0.21
86 0.22
87 0.22
88 0.24
89 0.24
90 0.25
91 0.3
92 0.3
93 0.26
94 0.27
95 0.28
96 0.29
97 0.36
98 0.36
99 0.37
100 0.42
101 0.46
102 0.49
103 0.53
104 0.53
105 0.5
106 0.53
107 0.51
108 0.48
109 0.48
110 0.5
111 0.52
112 0.58
113 0.58
114 0.62
115 0.68
116 0.69
117 0.62
118 0.58
119 0.58
120 0.57
121 0.58
122 0.51
123 0.43
124 0.4
125 0.41
126 0.39
127 0.33
128 0.27
129 0.25
130 0.23
131 0.23
132 0.18
133 0.16
134 0.16
135 0.14
136 0.13
137 0.12
138 0.11
139 0.1
140 0.12
141 0.12
142 0.11
143 0.11