Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9ARM7

Protein Details
Accession R9ARM7   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-30DARRVQLRKPNPYNTKSNKRRVIKTPGGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG wic:J056_000174  -  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MVDARRVQLRKPNPYNTKSNKRRVIKTPGGQLRYLHIHKKPTVPKCGDCGLALSGVPALRPRGYATISKRQKSVTRAYGGSRCAHCVRERIVRAFLVEEAKIVKKVIKSQTAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.8
4 0.82
5 0.81
6 0.83
7 0.82
8 0.81
9 0.83
10 0.8
11 0.8
12 0.79
13 0.75
14 0.75
15 0.73
16 0.68
17 0.62
18 0.54
19 0.48
20 0.46
21 0.43
22 0.39
23 0.35
24 0.38
25 0.39
26 0.47
27 0.51
28 0.5
29 0.56
30 0.54
31 0.52
32 0.5
33 0.5
34 0.42
35 0.34
36 0.29
37 0.2
38 0.16
39 0.13
40 0.09
41 0.08
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.08
49 0.1
50 0.12
51 0.18
52 0.23
53 0.32
54 0.39
55 0.4
56 0.41
57 0.42
58 0.46
59 0.45
60 0.47
61 0.44
62 0.41
63 0.41
64 0.44
65 0.45
66 0.42
67 0.42
68 0.35
69 0.33
70 0.3
71 0.32
72 0.3
73 0.31
74 0.34
75 0.38
76 0.42
77 0.41
78 0.42
79 0.39
80 0.38
81 0.34
82 0.31
83 0.25
84 0.2
85 0.17
86 0.18
87 0.19
88 0.19
89 0.18
90 0.2
91 0.2
92 0.29
93 0.36