Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9AR90

Protein Details
Accession R9AR90   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MTPIVLAHTKRRRRRSAPELPQSESHydrophilic
NLS Segment(s)
PositionSequence
11-15RRRRR
Subcellular Location(s) nucl 18.5, mito_nucl 12.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
KEGG wic:J056_000069  -  
Amino Acid Sequences MTPIVLAHTKRRRRRSAPELPQSESFKCIGILDEESMFDMFDQMYNTPILTHRPNLTYYEMWYRNLKHYDHIAASVNLSSTSSSTSNVFKFTPHNSPVIKHHKNIDRGSDGSFSSSIFDNLSMLDSPSSAPTRPSMREVVVDGEIVTIEFSLRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.87
4 0.88
5 0.88
6 0.83
7 0.77
8 0.75
9 0.69
10 0.6
11 0.51
12 0.4
13 0.3
14 0.26
15 0.21
16 0.16
17 0.14
18 0.14
19 0.13
20 0.13
21 0.12
22 0.13
23 0.12
24 0.11
25 0.08
26 0.07
27 0.06
28 0.06
29 0.07
30 0.06
31 0.08
32 0.08
33 0.08
34 0.08
35 0.09
36 0.12
37 0.14
38 0.17
39 0.18
40 0.19
41 0.21
42 0.23
43 0.26
44 0.22
45 0.22
46 0.28
47 0.27
48 0.27
49 0.29
50 0.28
51 0.3
52 0.33
53 0.31
54 0.25
55 0.26
56 0.27
57 0.24
58 0.24
59 0.2
60 0.16
61 0.16
62 0.13
63 0.11
64 0.08
65 0.08
66 0.06
67 0.05
68 0.07
69 0.07
70 0.07
71 0.09
72 0.11
73 0.12
74 0.14
75 0.14
76 0.13
77 0.15
78 0.18
79 0.23
80 0.23
81 0.27
82 0.25
83 0.28
84 0.35
85 0.43
86 0.43
87 0.38
88 0.45
89 0.47
90 0.54
91 0.54
92 0.51
93 0.45
94 0.43
95 0.43
96 0.37
97 0.3
98 0.24
99 0.22
100 0.16
101 0.14
102 0.13
103 0.11
104 0.1
105 0.09
106 0.08
107 0.08
108 0.09
109 0.08
110 0.08
111 0.08
112 0.08
113 0.08
114 0.12
115 0.14
116 0.12
117 0.14
118 0.17
119 0.23
120 0.26
121 0.29
122 0.29
123 0.29
124 0.31
125 0.31
126 0.3
127 0.26
128 0.23
129 0.19
130 0.16
131 0.14
132 0.11
133 0.09
134 0.06