Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9AIH5

Protein Details
Accession R9AIH5   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
65-91GEGELKQKHKPQQKPQHKQAQANKPDGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008606  EIF4EBP  
Gene Ontology GO:0008190  F:eukaryotic initiation factor 4E binding  
GO:0003743  F:translation initiation factor activity  
GO:0045947  P:negative regulation of translational initiation  
KEGG wic:J056_003693  -  
Pfam View protein in Pfam  
PF05456  eIF_4EBP  
Amino Acid Sequences MDIPQKQAKLNLANTPRGSNFYASTPGGTRTVYSKADLLSLASSPLSKTPPTGLSNFPAAMSRDGEGELKQKHKPQQKPQHKQAQANKPDGNTNNHSQETTFEMDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.49
3 0.44
4 0.4
5 0.38
6 0.32
7 0.28
8 0.23
9 0.26
10 0.22
11 0.23
12 0.2
13 0.2
14 0.19
15 0.17
16 0.16
17 0.14
18 0.18
19 0.18
20 0.18
21 0.17
22 0.16
23 0.17
24 0.16
25 0.14
26 0.1
27 0.09
28 0.08
29 0.07
30 0.07
31 0.06
32 0.08
33 0.09
34 0.08
35 0.09
36 0.11
37 0.15
38 0.17
39 0.19
40 0.19
41 0.19
42 0.2
43 0.2
44 0.18
45 0.15
46 0.14
47 0.13
48 0.12
49 0.11
50 0.1
51 0.11
52 0.11
53 0.1
54 0.15
55 0.17
56 0.19
57 0.23
58 0.28
59 0.36
60 0.44
61 0.53
62 0.59
63 0.67
64 0.75
65 0.82
66 0.86
67 0.89
68 0.86
69 0.86
70 0.85
71 0.84
72 0.8
73 0.78
74 0.71
75 0.61
76 0.62
77 0.57
78 0.54
79 0.49
80 0.48
81 0.47
82 0.45
83 0.44
84 0.37
85 0.35
86 0.33
87 0.31