Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9AIG5

Protein Details
Accession R9AIG5   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
214-239KAVSKYQKALEKKQQKLDKKGIDYKIHydrophilic
NLS Segment(s)
PositionSequence
84-96AKLGKAASKKNKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
KEGG wic:J056_003581  -  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12307  RRM_NIFK_like  
Amino Acid Sequences MPKDATKKSINEGRKGNENVKKATQQNTQKNAGKKEDKFEDQDEININEYNSDSSDSDGSSDEEAISKESKPVPKVPTNSQVKAKLGKAASKKNKRGVVFVGHIPHGFYENEMRAYFSQFGDITRLRLSRNKKTGKSKHYAFIEFESLEVAEIVAETMNNYLIENRLLVVEVLDDKDINEHLFKGANRKFRPTPTDRIERLNFNKEKTEEEKQKAVSKYQKALEKKQQKLDKKGIDYKIPM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.65
3 0.65
4 0.64
5 0.62
6 0.6
7 0.59
8 0.62
9 0.58
10 0.6
11 0.6
12 0.63
13 0.68
14 0.69
15 0.72
16 0.71
17 0.72
18 0.72
19 0.72
20 0.7
21 0.64
22 0.65
23 0.64
24 0.62
25 0.6
26 0.56
27 0.51
28 0.43
29 0.42
30 0.37
31 0.31
32 0.28
33 0.24
34 0.21
35 0.16
36 0.16
37 0.14
38 0.12
39 0.13
40 0.11
41 0.11
42 0.12
43 0.11
44 0.12
45 0.12
46 0.12
47 0.1
48 0.1
49 0.09
50 0.09
51 0.09
52 0.1
53 0.11
54 0.1
55 0.13
56 0.17
57 0.21
58 0.24
59 0.3
60 0.35
61 0.4
62 0.45
63 0.47
64 0.52
65 0.55
66 0.56
67 0.55
68 0.53
69 0.49
70 0.49
71 0.44
72 0.4
73 0.34
74 0.37
75 0.37
76 0.43
77 0.51
78 0.56
79 0.62
80 0.64
81 0.69
82 0.64
83 0.6
84 0.54
85 0.49
86 0.41
87 0.38
88 0.32
89 0.27
90 0.25
91 0.22
92 0.19
93 0.15
94 0.12
95 0.09
96 0.1
97 0.11
98 0.12
99 0.12
100 0.14
101 0.12
102 0.14
103 0.15
104 0.12
105 0.12
106 0.1
107 0.11
108 0.13
109 0.13
110 0.12
111 0.13
112 0.14
113 0.14
114 0.2
115 0.26
116 0.31
117 0.41
118 0.47
119 0.52
120 0.62
121 0.7
122 0.72
123 0.73
124 0.67
125 0.65
126 0.62
127 0.57
128 0.48
129 0.41
130 0.36
131 0.28
132 0.25
133 0.18
134 0.13
135 0.11
136 0.09
137 0.06
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.04
146 0.04
147 0.05
148 0.05
149 0.06
150 0.07
151 0.07
152 0.07
153 0.06
154 0.06
155 0.06
156 0.06
157 0.05
158 0.06
159 0.07
160 0.07
161 0.07
162 0.06
163 0.08
164 0.08
165 0.09
166 0.09
167 0.08
168 0.09
169 0.13
170 0.14
171 0.23
172 0.27
173 0.36
174 0.38
175 0.45
176 0.49
177 0.52
178 0.6
179 0.56
180 0.61
181 0.59
182 0.67
183 0.62
184 0.65
185 0.62
186 0.62
187 0.62
188 0.63
189 0.58
190 0.52
191 0.56
192 0.5
193 0.52
194 0.5
195 0.54
196 0.53
197 0.55
198 0.58
199 0.55
200 0.62
201 0.58
202 0.6
203 0.59
204 0.57
205 0.59
206 0.59
207 0.63
208 0.63
209 0.7
210 0.72
211 0.73
212 0.74
213 0.77
214 0.8
215 0.81
216 0.84
217 0.84
218 0.83
219 0.81
220 0.83
221 0.79