Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R9AND8

Protein Details
Accession R9AND8    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
317-342SPLSSLPQAARPKKRRRLVVDSRLDLHydrophilic
NLS Segment(s)
PositionSequence
327-332RPKKRR
Subcellular Location(s) nucl 19, cyto 4, mito 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039781  Rad21/Rec8-like  
IPR006910  Rad21_Rec8_N  
Gene Ontology GO:0008278  C:cohesin complex  
GO:0005634  C:nucleus  
GO:0007062  P:sister chromatid cohesion  
KEGG wic:J056_003140  -  
Pfam View protein in Pfam  
PF04825  Rad21_Rec8_N  
Amino Acid Sequences MAILEVSTISCAISIFSSRLNSTELLTSRRDGYALVWIAATLPSKANLTNFKRLSKKDILNFSVPAFCQTLQDPPEPLALRLSSSLLIGVVRIYDKRLMFFEHDVQQVHNNLLKAINNTEMSSDGESINLLQHRARVDQITLDANQLHAPDNIQNLDLRLQLAEIDVTAGMTNALQDSNIASLTAFDSHSSGIGRADPTQQDLLFDPMIPMMPMDWSISSHAPLGPDIPANVAQSASHQFLQDRPPSRQIAAGFDDWGMPSEDIRRDFFEDIAQNVREEGLGENFFNFDIPLEGVKAQSVEERRRSREQGSQPISSSPLSSLPQAARPKKRRRLVVDSRLDLLDEELRGSRDNYLQNMER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.13
4 0.17
5 0.17
6 0.19
7 0.2
8 0.19
9 0.19
10 0.25
11 0.24
12 0.25
13 0.27
14 0.27
15 0.28
16 0.27
17 0.26
18 0.2
19 0.18
20 0.23
21 0.22
22 0.2
23 0.18
24 0.17
25 0.17
26 0.19
27 0.18
28 0.11
29 0.1
30 0.11
31 0.12
32 0.14
33 0.18
34 0.26
35 0.31
36 0.4
37 0.43
38 0.5
39 0.56
40 0.58
41 0.62
42 0.61
43 0.63
44 0.61
45 0.66
46 0.63
47 0.59
48 0.57
49 0.51
50 0.45
51 0.37
52 0.32
53 0.25
54 0.21
55 0.19
56 0.18
57 0.23
58 0.22
59 0.24
60 0.23
61 0.22
62 0.28
63 0.27
64 0.26
65 0.23
66 0.2
67 0.19
68 0.19
69 0.19
70 0.13
71 0.12
72 0.11
73 0.08
74 0.08
75 0.07
76 0.06
77 0.06
78 0.07
79 0.07
80 0.09
81 0.13
82 0.14
83 0.16
84 0.17
85 0.19
86 0.21
87 0.24
88 0.27
89 0.27
90 0.29
91 0.28
92 0.28
93 0.28
94 0.26
95 0.25
96 0.22
97 0.18
98 0.16
99 0.17
100 0.18
101 0.16
102 0.17
103 0.18
104 0.16
105 0.16
106 0.16
107 0.15
108 0.15
109 0.14
110 0.14
111 0.1
112 0.09
113 0.09
114 0.09
115 0.1
116 0.1
117 0.09
118 0.09
119 0.11
120 0.13
121 0.14
122 0.15
123 0.14
124 0.13
125 0.13
126 0.15
127 0.15
128 0.14
129 0.13
130 0.12
131 0.11
132 0.12
133 0.11
134 0.11
135 0.09
136 0.09
137 0.1
138 0.11
139 0.11
140 0.11
141 0.11
142 0.1
143 0.11
144 0.11
145 0.09
146 0.07
147 0.07
148 0.06
149 0.06
150 0.05
151 0.04
152 0.04
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.05
171 0.06
172 0.05
173 0.05
174 0.06
175 0.06
176 0.07
177 0.07
178 0.06
179 0.06
180 0.07
181 0.08
182 0.08
183 0.11
184 0.1
185 0.12
186 0.14
187 0.13
188 0.13
189 0.13
190 0.14
191 0.12
192 0.11
193 0.09
194 0.08
195 0.08
196 0.07
197 0.06
198 0.04
199 0.04
200 0.04
201 0.05
202 0.05
203 0.06
204 0.08
205 0.09
206 0.09
207 0.1
208 0.1
209 0.1
210 0.1
211 0.1
212 0.09
213 0.09
214 0.08
215 0.09
216 0.1
217 0.1
218 0.1
219 0.09
220 0.08
221 0.1
222 0.13
223 0.13
224 0.13
225 0.13
226 0.13
227 0.16
228 0.23
229 0.27
230 0.29
231 0.3
232 0.35
233 0.36
234 0.36
235 0.37
236 0.32
237 0.3
238 0.29
239 0.26
240 0.22
241 0.2
242 0.19
243 0.15
244 0.15
245 0.12
246 0.09
247 0.09
248 0.13
249 0.16
250 0.18
251 0.2
252 0.21
253 0.23
254 0.24
255 0.24
256 0.24
257 0.22
258 0.22
259 0.25
260 0.23
261 0.2
262 0.19
263 0.19
264 0.14
265 0.13
266 0.12
267 0.11
268 0.12
269 0.12
270 0.12
271 0.12
272 0.12
273 0.11
274 0.1
275 0.06
276 0.06
277 0.07
278 0.08
279 0.09
280 0.09
281 0.1
282 0.1
283 0.1
284 0.09
285 0.14
286 0.2
287 0.26
288 0.36
289 0.42
290 0.48
291 0.55
292 0.6
293 0.59
294 0.62
295 0.64
296 0.65
297 0.64
298 0.61
299 0.55
300 0.53
301 0.5
302 0.41
303 0.33
304 0.23
305 0.21
306 0.19
307 0.19
308 0.22
309 0.21
310 0.29
311 0.38
312 0.46
313 0.52
314 0.61
315 0.71
316 0.77
317 0.83
318 0.86
319 0.85
320 0.87
321 0.87
322 0.87
323 0.86
324 0.79
325 0.74
326 0.64
327 0.55
328 0.44
329 0.36
330 0.29
331 0.19
332 0.17
333 0.16
334 0.17
335 0.18
336 0.19
337 0.2
338 0.23
339 0.27
340 0.29