Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R622

Protein Details
Accession F4R622    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
129-150RNKTITKKPKTKSNPNESKPTEHydrophilic
210-230EREKAVKRYRQLKEERLRNGEBasic
NLS Segment(s)
PositionSequence
30-34RPPKK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_102115  -  
Amino Acid Sequences MPHKRAKASIRKELSFQKGNDLPPNKLGTRPPKKKSSIGTPTSSTNHGIKDMPKNMYRILNSEKIREEYKARMKEKDQKSKDESSRNGLLKKSKSDQLRIESGERLSDFNQRVEQSMRPKLSSVMKLARNKTITKKPKTKSNPNESKPTEEPIIHQTTKEFEPKPTKFSLNDIVMEPPMNLKKPCKKLLSTESYKKLPISNSQKIRIEEEREKAVKRYRQLKEERLRNGEMNLEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.65
3 0.57
4 0.55
5 0.52
6 0.54
7 0.58
8 0.53
9 0.48
10 0.45
11 0.51
12 0.43
13 0.42
14 0.46
15 0.48
16 0.55
17 0.62
18 0.64
19 0.68
20 0.72
21 0.75
22 0.74
23 0.74
24 0.73
25 0.69
26 0.66
27 0.59
28 0.59
29 0.54
30 0.49
31 0.42
32 0.34
33 0.29
34 0.26
35 0.26
36 0.27
37 0.33
38 0.36
39 0.38
40 0.39
41 0.4
42 0.41
43 0.44
44 0.4
45 0.36
46 0.36
47 0.39
48 0.38
49 0.4
50 0.39
51 0.36
52 0.37
53 0.34
54 0.32
55 0.33
56 0.4
57 0.45
58 0.45
59 0.48
60 0.52
61 0.6
62 0.66
63 0.69
64 0.64
65 0.62
66 0.65
67 0.69
68 0.7
69 0.68
70 0.61
71 0.56
72 0.59
73 0.54
74 0.51
75 0.45
76 0.45
77 0.4
78 0.42
79 0.4
80 0.38
81 0.39
82 0.42
83 0.44
84 0.42
85 0.43
86 0.4
87 0.38
88 0.34
89 0.3
90 0.26
91 0.21
92 0.18
93 0.15
94 0.19
95 0.18
96 0.18
97 0.2
98 0.19
99 0.2
100 0.21
101 0.23
102 0.23
103 0.28
104 0.28
105 0.25
106 0.25
107 0.27
108 0.29
109 0.28
110 0.26
111 0.26
112 0.32
113 0.37
114 0.39
115 0.41
116 0.39
117 0.4
118 0.43
119 0.47
120 0.5
121 0.54
122 0.61
123 0.6
124 0.67
125 0.74
126 0.77
127 0.77
128 0.79
129 0.8
130 0.75
131 0.81
132 0.73
133 0.7
134 0.61
135 0.54
136 0.45
137 0.35
138 0.33
139 0.3
140 0.34
141 0.27
142 0.26
143 0.23
144 0.24
145 0.26
146 0.3
147 0.26
148 0.25
149 0.35
150 0.37
151 0.41
152 0.41
153 0.42
154 0.36
155 0.4
156 0.41
157 0.34
158 0.34
159 0.3
160 0.28
161 0.25
162 0.25
163 0.2
164 0.17
165 0.17
166 0.19
167 0.21
168 0.27
169 0.36
170 0.44
171 0.52
172 0.53
173 0.53
174 0.59
175 0.66
176 0.68
177 0.67
178 0.69
179 0.67
180 0.64
181 0.63
182 0.55
183 0.49
184 0.43
185 0.44
186 0.45
187 0.48
188 0.53
189 0.58
190 0.63
191 0.61
192 0.64
193 0.61
194 0.59
195 0.57
196 0.54
197 0.56
198 0.53
199 0.54
200 0.54
201 0.57
202 0.55
203 0.57
204 0.62
205 0.61
206 0.67
207 0.74
208 0.78
209 0.79
210 0.82
211 0.82
212 0.78
213 0.75
214 0.68
215 0.6