Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R5A2

Protein Details
Accession F4R5A2    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
104-125NKPTYRKPRLVLKPASRPRPLRHydrophilic
NLS Segment(s)
PositionSequence
109-125RKPRLVLKPASRPRPLR
Subcellular Location(s) nucl 20, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
KEGG mlr:MELLADRAFT_115105  -  
Amino Acid Sequences MAMVSQSQTQPFSAQTMVELDVNCHLNKTPPPVPPRTYTPLTQDIRLKISNWVDDHYNPNEITTNGTTHGLVIKLQRVSLHLEQSPLRQRRLAKRSTPLLTNFNKPTYRKPRLVLKPASRPRPLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.14
4 0.15
5 0.15
6 0.14
7 0.13
8 0.16
9 0.18
10 0.17
11 0.15
12 0.14
13 0.17
14 0.19
15 0.26
16 0.28
17 0.32
18 0.38
19 0.44
20 0.47
21 0.47
22 0.51
23 0.5
24 0.47
25 0.43
26 0.43
27 0.46
28 0.44
29 0.43
30 0.41
31 0.36
32 0.37
33 0.35
34 0.31
35 0.27
36 0.27
37 0.27
38 0.24
39 0.23
40 0.21
41 0.22
42 0.25
43 0.21
44 0.21
45 0.17
46 0.17
47 0.17
48 0.15
49 0.16
50 0.12
51 0.12
52 0.1
53 0.11
54 0.1
55 0.09
56 0.1
57 0.08
58 0.08
59 0.09
60 0.12
61 0.12
62 0.12
63 0.12
64 0.13
65 0.19
66 0.2
67 0.22
68 0.19
69 0.21
70 0.22
71 0.28
72 0.36
73 0.34
74 0.33
75 0.33
76 0.39
77 0.47
78 0.54
79 0.56
80 0.54
81 0.58
82 0.64
83 0.64
84 0.62
85 0.56
86 0.56
87 0.53
88 0.53
89 0.49
90 0.47
91 0.5
92 0.47
93 0.54
94 0.57
95 0.61
96 0.59
97 0.61
98 0.66
99 0.7
100 0.78
101 0.77
102 0.76
103 0.78
104 0.82
105 0.85