Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9ANK2

Protein Details
Accession R9ANK2   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
196-233HVHPQSHTTKPKNRGVKRRLKDERKREQKRAENEAYNEBasic
NLS Segment(s)
PositionSequence
205-225KPKNRGVKRRLKDERKREQKR
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG wic:J056_003097  -  
Amino Acid Sequences MNKRKSQIDQDDGQSKRIRTDDTSGCTNKNKTLSTRIRKLPPPMPSSRTASGRASSVATTSAAKRTNVINVSRKKSAINYIRRIKSLVLELGATKIILNTLSAAIPFTLQLIPMIRKHLGNSTNAIRFLLRTRTVDVIDQVLPTDKEADIEMHQRSQSALRVVMLVGERREGEQGDSDQDGNQDEQQQPQPHAHAHVHPQSHTTKPKNRGVKRRLKDERKREQKRAENEAYNETNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.46
3 0.45
4 0.42
5 0.39
6 0.34
7 0.41
8 0.43
9 0.42
10 0.5
11 0.47
12 0.48
13 0.51
14 0.49
15 0.47
16 0.45
17 0.44
18 0.41
19 0.49
20 0.55
21 0.59
22 0.65
23 0.68
24 0.7
25 0.72
26 0.75
27 0.72
28 0.69
29 0.66
30 0.64
31 0.61
32 0.57
33 0.57
34 0.55
35 0.51
36 0.47
37 0.42
38 0.37
39 0.34
40 0.3
41 0.25
42 0.2
43 0.17
44 0.15
45 0.13
46 0.13
47 0.13
48 0.17
49 0.19
50 0.19
51 0.2
52 0.2
53 0.25
54 0.28
55 0.32
56 0.36
57 0.41
58 0.46
59 0.47
60 0.46
61 0.42
62 0.4
63 0.44
64 0.44
65 0.45
66 0.49
67 0.56
68 0.58
69 0.57
70 0.56
71 0.47
72 0.4
73 0.34
74 0.26
75 0.17
76 0.15
77 0.14
78 0.13
79 0.13
80 0.1
81 0.07
82 0.06
83 0.05
84 0.05
85 0.05
86 0.04
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.07
99 0.09
100 0.1
101 0.12
102 0.12
103 0.12
104 0.13
105 0.18
106 0.18
107 0.18
108 0.2
109 0.22
110 0.23
111 0.23
112 0.22
113 0.17
114 0.16
115 0.17
116 0.19
117 0.17
118 0.16
119 0.18
120 0.2
121 0.21
122 0.21
123 0.19
124 0.16
125 0.14
126 0.13
127 0.11
128 0.11
129 0.1
130 0.09
131 0.1
132 0.08
133 0.08
134 0.08
135 0.1
136 0.1
137 0.14
138 0.15
139 0.16
140 0.16
141 0.16
142 0.16
143 0.16
144 0.18
145 0.15
146 0.15
147 0.13
148 0.14
149 0.13
150 0.15
151 0.14
152 0.13
153 0.11
154 0.12
155 0.12
156 0.12
157 0.14
158 0.12
159 0.12
160 0.13
161 0.14
162 0.15
163 0.16
164 0.15
165 0.15
166 0.15
167 0.15
168 0.14
169 0.14
170 0.16
171 0.16
172 0.2
173 0.26
174 0.29
175 0.29
176 0.31
177 0.32
178 0.29
179 0.33
180 0.32
181 0.29
182 0.34
183 0.38
184 0.38
185 0.36
186 0.39
187 0.38
188 0.43
189 0.48
190 0.49
191 0.52
192 0.58
193 0.66
194 0.73
195 0.79
196 0.82
197 0.83
198 0.85
199 0.84
200 0.87
201 0.89
202 0.89
203 0.91
204 0.91
205 0.91
206 0.92
207 0.93
208 0.92
209 0.92
210 0.9
211 0.89
212 0.88
213 0.85
214 0.82
215 0.75
216 0.73