Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9AK36

Protein Details
Accession R9AK36   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
76-105MELLRNSKDKKARKLTKKRLGTLRRAKGKVBasic
NLS Segment(s)
PositionSequence
40-56KRVKPSHRKGANSERGR
80-104RNSKDKKARKLTKKRLGTLRRAKGK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG wic:J056_000944  -  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MRISEISDFWRDGEERVMSTTTNNLRVGLNKGYPTTQLPKRVKPSHRKGANSERGRLVKGVIREVAGFAPYEKRVMELLRNSKDKKARKLTKKRLGTLRRAKGKVEELSSVIQEARTKGTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.2
4 0.21
5 0.17
6 0.17
7 0.23
8 0.22
9 0.25
10 0.24
11 0.23
12 0.23
13 0.26
14 0.29
15 0.26
16 0.25
17 0.22
18 0.23
19 0.23
20 0.24
21 0.25
22 0.28
23 0.29
24 0.36
25 0.4
26 0.46
27 0.54
28 0.61
29 0.66
30 0.7
31 0.75
32 0.75
33 0.77
34 0.74
35 0.72
36 0.74
37 0.75
38 0.68
39 0.61
40 0.56
41 0.5
42 0.47
43 0.4
44 0.3
45 0.23
46 0.2
47 0.19
48 0.14
49 0.13
50 0.12
51 0.12
52 0.11
53 0.09
54 0.08
55 0.06
56 0.08
57 0.08
58 0.09
59 0.09
60 0.1
61 0.11
62 0.12
63 0.16
64 0.21
65 0.28
66 0.34
67 0.4
68 0.41
69 0.46
70 0.53
71 0.56
72 0.59
73 0.63
74 0.67
75 0.72
76 0.82
77 0.87
78 0.88
79 0.9
80 0.88
81 0.87
82 0.85
83 0.85
84 0.84
85 0.83
86 0.83
87 0.76
88 0.7
89 0.66
90 0.65
91 0.6
92 0.53
93 0.45
94 0.38
95 0.38
96 0.36
97 0.31
98 0.24
99 0.2
100 0.19
101 0.18