Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9AS01

Protein Details
Accession R9AS01   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
146-171GVDPNVQLSKKQRKKLNKKLREQQQKHydrophilic
NLS Segment(s)
PositionSequence
155-166KKQRKKLNKKLR
Subcellular Location(s) nucl 16, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
KEGG wic:J056_003398  -  
Amino Acid Sequences MSSEVDLNELQAQISLSLGTIREMTSGWQKPSRSAGSTSIAASAPKQDDLTEWMSRPSRLGLGAAPAQTSVPTVDAKLQRKLTQKTPKDGSKSTKSDGEDAKDNANDDEDEGSRYTNTSASMANKKKSSIKSYLDKPHSAKKAVVGVDPNVQLSKKQRKKLNKKLREQQQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.06
4 0.07
5 0.07
6 0.07
7 0.08
8 0.08
9 0.08
10 0.09
11 0.11
12 0.19
13 0.23
14 0.27
15 0.32
16 0.32
17 0.35
18 0.42
19 0.43
20 0.37
21 0.35
22 0.35
23 0.34
24 0.35
25 0.32
26 0.26
27 0.23
28 0.2
29 0.17
30 0.18
31 0.15
32 0.14
33 0.14
34 0.12
35 0.13
36 0.17
37 0.21
38 0.18
39 0.17
40 0.21
41 0.22
42 0.22
43 0.22
44 0.19
45 0.15
46 0.14
47 0.14
48 0.1
49 0.12
50 0.14
51 0.13
52 0.12
53 0.11
54 0.1
55 0.1
56 0.1
57 0.07
58 0.06
59 0.06
60 0.06
61 0.11
62 0.18
63 0.21
64 0.26
65 0.28
66 0.32
67 0.39
68 0.42
69 0.46
70 0.5
71 0.51
72 0.53
73 0.57
74 0.56
75 0.54
76 0.55
77 0.52
78 0.5
79 0.5
80 0.45
81 0.44
82 0.4
83 0.39
84 0.37
85 0.34
86 0.29
87 0.27
88 0.27
89 0.23
90 0.22
91 0.18
92 0.17
93 0.14
94 0.1
95 0.11
96 0.09
97 0.1
98 0.1
99 0.1
100 0.09
101 0.09
102 0.09
103 0.08
104 0.09
105 0.09
106 0.11
107 0.15
108 0.25
109 0.3
110 0.34
111 0.34
112 0.36
113 0.43
114 0.47
115 0.48
116 0.47
117 0.49
118 0.52
119 0.59
120 0.67
121 0.65
122 0.65
123 0.62
124 0.64
125 0.62
126 0.57
127 0.49
128 0.44
129 0.45
130 0.41
131 0.4
132 0.34
133 0.3
134 0.33
135 0.32
136 0.29
137 0.24
138 0.23
139 0.24
140 0.31
141 0.4
142 0.43
143 0.51
144 0.59
145 0.69
146 0.8
147 0.87
148 0.89
149 0.88
150 0.9
151 0.93