Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9AJS9

Protein Details
Accession R9AJS9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
76-100DKLKNKRSDSETRKQKRDNSKSVWEHydrophilic
NLS Segment(s)
PositionSequence
45-92SNASHKGLGRKKSTKQRTRTSKAAERAAEHADKLKNKRSDSETRKQKR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
KEGG wic:J056_000819  -  
Amino Acid Sequences MPKLSKLERKAQPEPPVNLGDVDDGLDNRHELEKKVASVKARNSSNASHKGLGRKKSTKQRTRTSKAAERAAEHADKLKNKRSDSETRKQKRDNSKSVWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.63
3 0.57
4 0.49
5 0.42
6 0.34
7 0.26
8 0.17
9 0.14
10 0.1
11 0.08
12 0.09
13 0.08
14 0.08
15 0.08
16 0.12
17 0.12
18 0.13
19 0.18
20 0.19
21 0.21
22 0.25
23 0.26
24 0.26
25 0.3
26 0.34
27 0.37
28 0.36
29 0.36
30 0.35
31 0.36
32 0.4
33 0.41
34 0.38
35 0.33
36 0.33
37 0.39
38 0.42
39 0.44
40 0.45
41 0.44
42 0.49
43 0.58
44 0.67
45 0.67
46 0.7
47 0.75
48 0.78
49 0.79
50 0.79
51 0.77
52 0.75
53 0.72
54 0.7
55 0.62
56 0.54
57 0.5
58 0.46
59 0.39
60 0.31
61 0.3
62 0.29
63 0.33
64 0.37
65 0.43
66 0.45
67 0.46
68 0.52
69 0.54
70 0.6
71 0.62
72 0.67
73 0.69
74 0.73
75 0.8
76 0.8
77 0.83
78 0.83
79 0.85
80 0.84