Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9AGN1

Protein Details
Accession R9AGN1   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKSNIRNKRVKKNLRVRFLLDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 8
Family & Domain DBs
KEGG wic:J056_004591  -  
Amino Acid Sequences MKSNIRNKRVKKNLRVRFLLDPSTDRSIHVGYDKGGYDNKRRAVNTSVYTHAPAAYSTTRSRCYICDSYRRGTSSAGSLSSSSQSHKRSAGSSIGGSLGNHSNHNSFYSHINNSAGSLNRIPPYYDYYTGIVSSLTPQMHVYYC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.84
3 0.78
4 0.76
5 0.7
6 0.65
7 0.56
8 0.49
9 0.45
10 0.45
11 0.39
12 0.31
13 0.29
14 0.24
15 0.23
16 0.22
17 0.18
18 0.14
19 0.17
20 0.17
21 0.16
22 0.2
23 0.22
24 0.27
25 0.33
26 0.37
27 0.39
28 0.39
29 0.41
30 0.42
31 0.44
32 0.41
33 0.38
34 0.36
35 0.31
36 0.32
37 0.28
38 0.24
39 0.18
40 0.13
41 0.13
42 0.12
43 0.14
44 0.15
45 0.18
46 0.2
47 0.21
48 0.22
49 0.2
50 0.26
51 0.3
52 0.31
53 0.37
54 0.38
55 0.4
56 0.43
57 0.43
58 0.36
59 0.3
60 0.27
61 0.21
62 0.18
63 0.15
64 0.12
65 0.11
66 0.11
67 0.12
68 0.12
69 0.11
70 0.16
71 0.17
72 0.19
73 0.21
74 0.21
75 0.21
76 0.23
77 0.24
78 0.2
79 0.18
80 0.17
81 0.16
82 0.15
83 0.13
84 0.13
85 0.14
86 0.14
87 0.14
88 0.15
89 0.15
90 0.16
91 0.18
92 0.16
93 0.13
94 0.17
95 0.2
96 0.21
97 0.22
98 0.22
99 0.2
100 0.21
101 0.24
102 0.21
103 0.19
104 0.19
105 0.21
106 0.22
107 0.23
108 0.22
109 0.21
110 0.27
111 0.29
112 0.29
113 0.28
114 0.27
115 0.28
116 0.27
117 0.25
118 0.18
119 0.13
120 0.13
121 0.15
122 0.14
123 0.14
124 0.14