Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9AKR7

Protein Details
Accession R9AKR7    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-40IYASKGQKKDAPAKKQRRRSFQQDYHGYRTFHydrophilic
NLS Segment(s)
PositionSequence
17-28KKDAPAKKQRRR
Subcellular Location(s) extr 21, vacu 2, nucl 1, mito 1, cyto 1, cyto_nucl 1, golg 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR045328  Kre9/Knh1  
IPR018466  Kre9/Knh1-like_N  
Gene Ontology GO:0006078  P:(1->6)-beta-D-glucan biosynthetic process  
GO:0042546  P:cell wall biogenesis  
KEGG wic:J056_003361  -  
Pfam View protein in Pfam  
PF10342  Kre9_KNH  
Amino Acid Sequences MTVVAIVSAIYASKGQKKDAPAKKQRRRSFQQDYHGYRTFAFKMLKSIFALSAIASKTLANLAITQPLSGDKVEAGNEYTVKWTQKGDNVTLSDIGQSHIYLFAGNESLAMVPLSQLGTVDATEKEFTTTIDPDVGQDGIFYSLRIVSDSLPAQTEEASNYGYPYIAYTGIFGLTGMTGTFNETLLNATNTGKADYDDNSESYNNTDNNISNSEKNIIDENGDSSTNKSTSNDNGSGDKDDDSSASKSKAFAAMGAIILGAAVYLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.3
4 0.37
5 0.47
6 0.55
7 0.62
8 0.66
9 0.75
10 0.82
11 0.88
12 0.9
13 0.9
14 0.89
15 0.88
16 0.88
17 0.86
18 0.86
19 0.86
20 0.83
21 0.81
22 0.76
23 0.66
24 0.56
25 0.52
26 0.43
27 0.39
28 0.34
29 0.27
30 0.31
31 0.32
32 0.34
33 0.3
34 0.3
35 0.24
36 0.22
37 0.22
38 0.14
39 0.16
40 0.13
41 0.12
42 0.11
43 0.1
44 0.1
45 0.11
46 0.11
47 0.08
48 0.09
49 0.09
50 0.14
51 0.14
52 0.13
53 0.13
54 0.13
55 0.14
56 0.12
57 0.12
58 0.07
59 0.09
60 0.09
61 0.1
62 0.1
63 0.1
64 0.1
65 0.1
66 0.12
67 0.14
68 0.15
69 0.15
70 0.16
71 0.17
72 0.22
73 0.25
74 0.25
75 0.27
76 0.27
77 0.27
78 0.25
79 0.22
80 0.18
81 0.15
82 0.13
83 0.09
84 0.08
85 0.07
86 0.07
87 0.07
88 0.06
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.04
99 0.03
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.05
107 0.06
108 0.05
109 0.06
110 0.07
111 0.07
112 0.08
113 0.07
114 0.08
115 0.09
116 0.09
117 0.09
118 0.09
119 0.09
120 0.08
121 0.09
122 0.08
123 0.06
124 0.05
125 0.05
126 0.06
127 0.06
128 0.06
129 0.05
130 0.06
131 0.06
132 0.07
133 0.07
134 0.06
135 0.09
136 0.09
137 0.09
138 0.09
139 0.09
140 0.09
141 0.09
142 0.09
143 0.07
144 0.07
145 0.08
146 0.07
147 0.07
148 0.07
149 0.07
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.06
158 0.06
159 0.06
160 0.05
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.06
167 0.06
168 0.06
169 0.06
170 0.06
171 0.07
172 0.08
173 0.09
174 0.09
175 0.09
176 0.11
177 0.12
178 0.13
179 0.12
180 0.11
181 0.12
182 0.12
183 0.17
184 0.16
185 0.16
186 0.17
187 0.17
188 0.17
189 0.17
190 0.2
191 0.16
192 0.16
193 0.17
194 0.16
195 0.19
196 0.23
197 0.23
198 0.2
199 0.22
200 0.24
201 0.22
202 0.22
203 0.22
204 0.19
205 0.18
206 0.17
207 0.17
208 0.16
209 0.16
210 0.15
211 0.15
212 0.18
213 0.17
214 0.18
215 0.17
216 0.19
217 0.24
218 0.31
219 0.32
220 0.3
221 0.32
222 0.33
223 0.35
224 0.33
225 0.28
226 0.22
227 0.19
228 0.18
229 0.19
230 0.2
231 0.2
232 0.21
233 0.21
234 0.21
235 0.23
236 0.26
237 0.22
238 0.2
239 0.2
240 0.19
241 0.19
242 0.18
243 0.15
244 0.1
245 0.09
246 0.08