Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R9AH46

Protein Details
Accession R9AH46    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
39-58TKSDKDTKKMLKRREKDFKSBasic
NLS Segment(s)
PositionSequence
43-95KDTKKMLKRREKDFKSAEKHLSKAEKQVEAEAKANKKVDKTAKAQLKASEKKT
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
KEGG wic:J056_001916  -  
Amino Acid Sequences MSEGDNQQNVSNNLENNTGSGEREGLSAQENERRMKDLTKSDKDTKKMLKRREKDFKSAEKHLSKAEKQVEAEAKANKKVDKTAKAQLKASEKKTAAEAKLNKANANSESAKQGLGQAKETHVKRKSELENMTHEREKARSERTKVEREIGSVKPTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.21
4 0.23
5 0.19
6 0.16
7 0.15
8 0.14
9 0.12
10 0.13
11 0.13
12 0.1
13 0.12
14 0.13
15 0.14
16 0.19
17 0.22
18 0.24
19 0.25
20 0.27
21 0.26
22 0.28
23 0.32
24 0.37
25 0.43
26 0.48
27 0.54
28 0.6
29 0.65
30 0.65
31 0.66
32 0.66
33 0.67
34 0.67
35 0.71
36 0.72
37 0.73
38 0.8
39 0.83
40 0.78
41 0.77
42 0.76
43 0.75
44 0.71
45 0.69
46 0.67
47 0.59
48 0.56
49 0.52
50 0.5
51 0.42
52 0.43
53 0.41
54 0.35
55 0.32
56 0.35
57 0.33
58 0.29
59 0.31
60 0.28
61 0.26
62 0.26
63 0.28
64 0.25
65 0.22
66 0.26
67 0.29
68 0.31
69 0.33
70 0.38
71 0.43
72 0.44
73 0.45
74 0.45
75 0.48
76 0.48
77 0.47
78 0.46
79 0.4
80 0.39
81 0.41
82 0.41
83 0.33
84 0.34
85 0.35
86 0.33
87 0.38
88 0.38
89 0.35
90 0.31
91 0.32
92 0.26
93 0.28
94 0.24
95 0.19
96 0.21
97 0.2
98 0.19
99 0.17
100 0.21
101 0.21
102 0.2
103 0.22
104 0.21
105 0.24
106 0.32
107 0.34
108 0.38
109 0.38
110 0.4
111 0.39
112 0.47
113 0.49
114 0.51
115 0.54
116 0.49
117 0.53
118 0.56
119 0.59
120 0.53
121 0.48
122 0.42
123 0.39
124 0.4
125 0.37
126 0.41
127 0.44
128 0.47
129 0.56
130 0.62
131 0.69
132 0.67
133 0.67
134 0.6
135 0.55
136 0.55
137 0.48