Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9AF45

Protein Details
Accession R9AF45    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MLKPRPKLPHTKSTVKAFKPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 2.5, cyto_nucl 2.5
Family & Domain DBs
KEGG wic:J056_000618  -  
Amino Acid Sequences MLKPRPKLPHTKSTVKAFKPHLSLGSVPQTPSSRPFDPRQLLGHTPTSPKLLAALGRLATAIDTAFPKVEAHEHNVWFRYVDLGLSLGFRPVDGYVPAEGAEVDDLDMSKLQLAEVTLYNSHKLQQDPAFPFLPLVIPPPRSASQATTPAVSRSNSVSSNASGRSYVSMDSKWPAPPSLTPVSSLGSSGFAGGLTSGLAGMSTLDSDRPSTPGTPGTPGGALPRGSVELTETAMLQNFIKTLGDPEESLEEPTPSNSIVHAPRTQIVKVWPKVAIKAQFAAPPGSDMARQFDSRWLTVSISDADGFDEDPPAKEIVGEME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.73
3 0.74
4 0.7
5 0.69
6 0.65
7 0.61
8 0.53
9 0.47
10 0.45
11 0.42
12 0.43
13 0.38
14 0.33
15 0.34
16 0.34
17 0.32
18 0.36
19 0.37
20 0.33
21 0.37
22 0.43
23 0.48
24 0.5
25 0.52
26 0.51
27 0.5
28 0.49
29 0.48
30 0.47
31 0.4
32 0.39
33 0.37
34 0.36
35 0.3
36 0.26
37 0.23
38 0.2
39 0.19
40 0.17
41 0.19
42 0.16
43 0.16
44 0.16
45 0.14
46 0.12
47 0.1
48 0.08
49 0.06
50 0.07
51 0.08
52 0.08
53 0.09
54 0.09
55 0.09
56 0.15
57 0.16
58 0.21
59 0.27
60 0.29
61 0.32
62 0.33
63 0.32
64 0.27
65 0.25
66 0.2
67 0.14
68 0.12
69 0.09
70 0.08
71 0.08
72 0.09
73 0.09
74 0.08
75 0.07
76 0.07
77 0.08
78 0.08
79 0.09
80 0.08
81 0.1
82 0.09
83 0.09
84 0.1
85 0.09
86 0.08
87 0.07
88 0.06
89 0.05
90 0.04
91 0.04
92 0.04
93 0.04
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.06
101 0.07
102 0.07
103 0.09
104 0.1
105 0.11
106 0.12
107 0.12
108 0.15
109 0.16
110 0.16
111 0.19
112 0.21
113 0.28
114 0.29
115 0.32
116 0.3
117 0.27
118 0.26
119 0.22
120 0.19
121 0.11
122 0.12
123 0.12
124 0.12
125 0.13
126 0.17
127 0.18
128 0.2
129 0.2
130 0.2
131 0.21
132 0.25
133 0.25
134 0.22
135 0.21
136 0.21
137 0.22
138 0.19
139 0.16
140 0.12
141 0.14
142 0.14
143 0.15
144 0.15
145 0.14
146 0.15
147 0.15
148 0.13
149 0.11
150 0.11
151 0.1
152 0.1
153 0.1
154 0.1
155 0.09
156 0.1
157 0.11
158 0.13
159 0.13
160 0.13
161 0.13
162 0.13
163 0.13
164 0.18
165 0.2
166 0.19
167 0.19
168 0.19
169 0.19
170 0.18
171 0.18
172 0.12
173 0.09
174 0.09
175 0.07
176 0.06
177 0.05
178 0.05
179 0.04
180 0.04
181 0.03
182 0.03
183 0.03
184 0.02
185 0.02
186 0.02
187 0.03
188 0.03
189 0.03
190 0.03
191 0.04
192 0.05
193 0.07
194 0.07
195 0.09
196 0.11
197 0.11
198 0.13
199 0.16
200 0.17
201 0.18
202 0.18
203 0.17
204 0.16
205 0.15
206 0.16
207 0.16
208 0.15
209 0.12
210 0.12
211 0.12
212 0.12
213 0.12
214 0.11
215 0.09
216 0.09
217 0.09
218 0.09
219 0.08
220 0.09
221 0.09
222 0.08
223 0.07
224 0.07
225 0.07
226 0.07
227 0.07
228 0.09
229 0.11
230 0.12
231 0.12
232 0.13
233 0.16
234 0.16
235 0.18
236 0.17
237 0.14
238 0.14
239 0.14
240 0.14
241 0.11
242 0.11
243 0.1
244 0.14
245 0.17
246 0.21
247 0.23
248 0.24
249 0.27
250 0.3
251 0.3
252 0.28
253 0.33
254 0.38
255 0.38
256 0.39
257 0.4
258 0.39
259 0.42
260 0.46
261 0.45
262 0.38
263 0.38
264 0.37
265 0.35
266 0.35
267 0.33
268 0.26
269 0.21
270 0.2
271 0.19
272 0.18
273 0.17
274 0.2
275 0.22
276 0.23
277 0.22
278 0.28
279 0.31
280 0.29
281 0.31
282 0.27
283 0.25
284 0.24
285 0.26
286 0.21
287 0.19
288 0.18
289 0.16
290 0.15
291 0.14
292 0.14
293 0.12
294 0.14
295 0.13
296 0.14
297 0.16
298 0.15
299 0.14
300 0.14