Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S5D2

Protein Details
Accession F4S5D2    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGSKIPIVKKRTKPFIRHQSDRYHydrophilic
26-46VKPAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
10-14KRTKP
24-45ASVKPAWRKPKGIDNRVRRRFK
Subcellular Location(s) mito 11.5mito_nucl 11.5, nucl 10.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mlr:MELLADRAFT_50500  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MGSKIPIVKKRTKPFIRHQSDRYASVKPAWRKPKGIDNRVRRRFKGQLPMPSIGYGSNKKTRHLMPNGYRKFVVNNADELDLLLMHNKKYAAEIAHTVSARKRVLIVEKAKILGLKVTNGAAKLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.86
3 0.86
4 0.84
5 0.78
6 0.78
7 0.73
8 0.69
9 0.61
10 0.53
11 0.45
12 0.43
13 0.47
14 0.44
15 0.49
16 0.54
17 0.56
18 0.57
19 0.59
20 0.63
21 0.66
22 0.69
23 0.69
24 0.7
25 0.77
26 0.82
27 0.85
28 0.76
29 0.73
30 0.71
31 0.67
32 0.67
33 0.62
34 0.61
35 0.6
36 0.59
37 0.53
38 0.45
39 0.39
40 0.29
41 0.26
42 0.2
43 0.19
44 0.25
45 0.25
46 0.26
47 0.3
48 0.33
49 0.37
50 0.39
51 0.44
52 0.44
53 0.54
54 0.55
55 0.53
56 0.49
57 0.42
58 0.38
59 0.34
60 0.3
61 0.21
62 0.2
63 0.2
64 0.2
65 0.19
66 0.18
67 0.14
68 0.08
69 0.07
70 0.09
71 0.08
72 0.08
73 0.1
74 0.1
75 0.1
76 0.11
77 0.14
78 0.12
79 0.13
80 0.16
81 0.17
82 0.21
83 0.21
84 0.21
85 0.21
86 0.25
87 0.24
88 0.22
89 0.21
90 0.2
91 0.27
92 0.35
93 0.38
94 0.37
95 0.39
96 0.4
97 0.39
98 0.36
99 0.3
100 0.26
101 0.23
102 0.19
103 0.18
104 0.2
105 0.21
106 0.22
107 0.23
108 0.2