Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R4X8G7

Protein Details
Accession R4X8G7   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
297-321GAKPAVLIKKKKKGGPQLQQENSIVHydrophilic
NLS Segment(s)
PositionSequence
305-310KKKKKG
Subcellular Location(s) cyto 10cyto_nucl 10, nucl 8, mito 4, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004600  TFIIH_Tfb4/GTF2H3  
IPR036465  vWFA_dom_sf  
Gene Ontology GO:0000439  C:transcription factor TFIIH core complex  
GO:0005675  C:transcription factor TFIIH holo complex  
GO:0046872  F:metal ion binding  
GO:0006289  P:nucleotide-excision repair  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF03850  Tfb4  
Amino Acid Sequences MDRFDTLRHLNDDATHQDKNEGSLVVFILDTNPSAWASLSSPTLQQSLADIFIFLNAHLALSHTNKTAVIASHIGTARFLYPSPEETFKQPSERDLHREANAYKPFLAVQDEVLHNISTLLNSTTQLTIETSRTSMMSGAITLALSYINRHASSVGSSRIMILSVSGDLEMQYIPMMNCIFSAQKQKVMIDIAKVGGDAVFLQQASDATKGCYRNVRAGESLLGYLMGLFLPDQHVRRDLNLPAVANVDFRAACFCHKKVLDVGFVCSVCLSIFCQALPKCITCDSTFDVQEMKTFGAKPAVLIKKKKKGGPQLQQENSIVID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.28
4 0.31
5 0.3
6 0.31
7 0.28
8 0.22
9 0.18
10 0.18
11 0.18
12 0.14
13 0.13
14 0.1
15 0.09
16 0.09
17 0.09
18 0.08
19 0.09
20 0.08
21 0.09
22 0.09
23 0.09
24 0.1
25 0.12
26 0.14
27 0.14
28 0.15
29 0.17
30 0.17
31 0.16
32 0.15
33 0.15
34 0.14
35 0.14
36 0.13
37 0.11
38 0.1
39 0.11
40 0.11
41 0.09
42 0.09
43 0.08
44 0.08
45 0.07
46 0.08
47 0.1
48 0.13
49 0.15
50 0.14
51 0.15
52 0.15
53 0.16
54 0.18
55 0.15
56 0.15
57 0.14
58 0.14
59 0.19
60 0.2
61 0.18
62 0.17
63 0.17
64 0.15
65 0.14
66 0.14
67 0.12
68 0.12
69 0.16
70 0.2
71 0.23
72 0.23
73 0.25
74 0.31
75 0.3
76 0.34
77 0.3
78 0.32
79 0.34
80 0.37
81 0.39
82 0.39
83 0.42
84 0.38
85 0.43
86 0.4
87 0.42
88 0.42
89 0.37
90 0.31
91 0.27
92 0.26
93 0.21
94 0.23
95 0.14
96 0.12
97 0.15
98 0.15
99 0.15
100 0.16
101 0.15
102 0.12
103 0.12
104 0.11
105 0.07
106 0.07
107 0.07
108 0.07
109 0.07
110 0.08
111 0.08
112 0.08
113 0.08
114 0.09
115 0.1
116 0.1
117 0.1
118 0.1
119 0.1
120 0.1
121 0.09
122 0.09
123 0.08
124 0.07
125 0.06
126 0.06
127 0.05
128 0.05
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.06
135 0.08
136 0.08
137 0.08
138 0.09
139 0.09
140 0.11
141 0.13
142 0.12
143 0.11
144 0.11
145 0.11
146 0.11
147 0.1
148 0.08
149 0.06
150 0.05
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.03
160 0.04
161 0.04
162 0.06
163 0.06
164 0.05
165 0.06
166 0.07
167 0.07
168 0.09
169 0.16
170 0.16
171 0.19
172 0.2
173 0.2
174 0.21
175 0.23
176 0.21
177 0.15
178 0.15
179 0.12
180 0.11
181 0.11
182 0.09
183 0.07
184 0.06
185 0.05
186 0.04
187 0.05
188 0.04
189 0.04
190 0.05
191 0.05
192 0.07
193 0.08
194 0.07
195 0.09
196 0.13
197 0.14
198 0.16
199 0.22
200 0.22
201 0.28
202 0.31
203 0.32
204 0.29
205 0.29
206 0.28
207 0.23
208 0.21
209 0.14
210 0.11
211 0.08
212 0.07
213 0.06
214 0.04
215 0.03
216 0.03
217 0.03
218 0.07
219 0.1
220 0.12
221 0.13
222 0.17
223 0.18
224 0.21
225 0.25
226 0.23
227 0.26
228 0.27
229 0.26
230 0.23
231 0.24
232 0.22
233 0.18
234 0.17
235 0.13
236 0.1
237 0.1
238 0.12
239 0.11
240 0.16
241 0.21
242 0.21
243 0.28
244 0.28
245 0.31
246 0.34
247 0.37
248 0.39
249 0.34
250 0.37
251 0.33
252 0.32
253 0.3
254 0.24
255 0.2
256 0.13
257 0.13
258 0.11
259 0.09
260 0.1
261 0.1
262 0.18
263 0.18
264 0.23
265 0.25
266 0.25
267 0.25
268 0.27
269 0.3
270 0.24
271 0.29
272 0.28
273 0.31
274 0.3
275 0.28
276 0.28
277 0.25
278 0.26
279 0.23
280 0.2
281 0.17
282 0.17
283 0.19
284 0.22
285 0.22
286 0.21
287 0.29
288 0.38
289 0.42
290 0.51
291 0.6
292 0.64
293 0.72
294 0.76
295 0.76
296 0.78
297 0.81
298 0.82
299 0.83
300 0.84
301 0.81
302 0.8
303 0.72