Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R4XD74

Protein Details
Accession R4XD74    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-46KVEKQEKPKQPKGRALKRIKYNRRFVNBasic
NLS Segment(s)
PositionSequence
12-41GKVKSQTPKVEKQEKPKQPKGRALKRIKYN
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKPKQPKGRALKRIKYNRRFVNVTNMVGGKRRMNPNPVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.49
5 0.53
6 0.62
7 0.65
8 0.7
9 0.69
10 0.71
11 0.74
12 0.75
13 0.78
14 0.78
15 0.79
16 0.76
17 0.8
18 0.8
19 0.79
20 0.8
21 0.8
22 0.79
23 0.79
24 0.83
25 0.85
26 0.83
27 0.83
28 0.8
29 0.77
30 0.73
31 0.65
32 0.65
33 0.59
34 0.51
35 0.45
36 0.39
37 0.33
38 0.33
39 0.34
40 0.28
41 0.31
42 0.39
43 0.41