Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RP55

Protein Details
Accession F4RP55    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
100-127CQCSCKPTCKSEPKPEPKPEPKPEPPKAHydrophilic
NLS Segment(s)
PositionSequence
113-131KPEPKPEPKPEPPKAEPPK
Subcellular Location(s) extr 15, mito 4, E.R. 3, pero 2, golg 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
KEGG mlr:MELLADRAFT_63790  -  
Amino Acid Sequences MRLSFQFTLLLLAISFSTITSAPAEPSSALGVATPPGGAKPLGGEDAKKTEGEAAKKPGLEGIGSKTLGAEKTDGPGKLESKSKSEGTGKFESGDSMCTCQCSCKPTCKSEPKPEPKPEPKPEPPKAEPPKPDIKSPEGSYPSSAMGGFSELGSQIQITFLAIMVTIMTLYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.05
4 0.06
5 0.06
6 0.08
7 0.09
8 0.1
9 0.11
10 0.11
11 0.13
12 0.11
13 0.12
14 0.12
15 0.1
16 0.09
17 0.08
18 0.08
19 0.08
20 0.08
21 0.07
22 0.05
23 0.05
24 0.07
25 0.07
26 0.06
27 0.07
28 0.08
29 0.11
30 0.11
31 0.12
32 0.14
33 0.18
34 0.19
35 0.17
36 0.16
37 0.18
38 0.22
39 0.25
40 0.27
41 0.29
42 0.3
43 0.3
44 0.3
45 0.26
46 0.22
47 0.19
48 0.15
49 0.14
50 0.15
51 0.15
52 0.15
53 0.14
54 0.15
55 0.15
56 0.14
57 0.12
58 0.08
59 0.1
60 0.14
61 0.13
62 0.14
63 0.16
64 0.16
65 0.17
66 0.22
67 0.21
68 0.21
69 0.25
70 0.23
71 0.25
72 0.29
73 0.29
74 0.3
75 0.32
76 0.29
77 0.26
78 0.26
79 0.23
80 0.18
81 0.18
82 0.12
83 0.11
84 0.1
85 0.11
86 0.11
87 0.12
88 0.13
89 0.16
90 0.18
91 0.26
92 0.31
93 0.36
94 0.46
95 0.55
96 0.62
97 0.68
98 0.76
99 0.76
100 0.81
101 0.82
102 0.83
103 0.82
104 0.83
105 0.81
106 0.79
107 0.79
108 0.8
109 0.8
110 0.78
111 0.73
112 0.74
113 0.74
114 0.73
115 0.68
116 0.64
117 0.67
118 0.61
119 0.62
120 0.56
121 0.53
122 0.51
123 0.5
124 0.52
125 0.45
126 0.44
127 0.4
128 0.36
129 0.32
130 0.26
131 0.23
132 0.15
133 0.11
134 0.11
135 0.1
136 0.09
137 0.08
138 0.08
139 0.08
140 0.08
141 0.07
142 0.06
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.06
149 0.05
150 0.05
151 0.05
152 0.05