Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5EFE7

Protein Details
Accession M5EFE7   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25TNKRKKNKKKKKKKLMSRWLFSTNAHydrophilic
NLS Segment(s)
PositionSequence
3-15KRKKNKKKKKKKL
Subcellular Location(s) plas 13, nucl 7.5, mito_nucl 6, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023616  Cyt_c_oxase-like_su1_dom  
IPR036927  Cyt_c_oxase-like_su1_sf  
IPR000883  Cyt_C_Oxase_1  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0070469  C:respirasome  
GO:0004129  F:cytochrome-c oxidase activity  
GO:0020037  F:heme binding  
GO:0046872  F:metal ion binding  
GO:0006119  P:oxidative phosphorylation  
Pfam View protein in Pfam  
PF00115  COX1  
PROSITE View protein in PROSITE  
PS50855  COX1  
Amino Acid Sequences TNKRKKNKKKKKKKLMSRWLFSTNAKDIGMLYLMFGLFSGMIGTAFSVLIRLELASPGAQYLQGDNQLYNVIVTAHAFLMIFFMVIAKSDFNYNLVLFKYNLVSSANNSKSLTDSTNLNSNNFTGLQQKKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.97
3 0.96
4 0.92
5 0.87
6 0.81
7 0.73
8 0.65
9 0.59
10 0.52
11 0.44
12 0.36
13 0.29
14 0.24
15 0.21
16 0.2
17 0.13
18 0.1
19 0.07
20 0.07
21 0.07
22 0.06
23 0.05
24 0.04
25 0.04
26 0.04
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.04
33 0.03
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.08
56 0.07
57 0.06
58 0.04
59 0.04
60 0.04
61 0.05
62 0.04
63 0.05
64 0.05
65 0.04
66 0.05
67 0.04
68 0.04
69 0.03
70 0.04
71 0.03
72 0.04
73 0.05
74 0.04
75 0.05
76 0.06
77 0.07
78 0.08
79 0.09
80 0.09
81 0.11
82 0.11
83 0.13
84 0.12
85 0.13
86 0.14
87 0.12
88 0.13
89 0.13
90 0.13
91 0.15
92 0.25
93 0.25
94 0.26
95 0.27
96 0.26
97 0.27
98 0.28
99 0.27
100 0.19
101 0.2
102 0.2
103 0.28
104 0.29
105 0.28
106 0.26
107 0.24
108 0.25
109 0.23
110 0.21
111 0.23