Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R4XLJ0

Protein Details
Accession R4XLJ0   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
126-152TQKFYEKPSNKRVRLNRERHRKRFLSGHydrophilic
NLS Segment(s)
PositionSequence
135-149NKRVRLNRERHRKRF
Subcellular Location(s) nucl 12.5, mito 9, cyto_nucl 8, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MMHFSLLSVPLLPLRQISLLRQATTDAKKSSEDTSDNSKIGDDWTAILKTMDQGRKQNTRYQNNPLPDLMPKAAFLSNIRRPVAASGPFSTYAGRTKEVKNGDISAAFRALNSTLRNNSVARDYRTQKFYEKPSNKRVRLNRERHRKRFLSGVKRLVNLVKEQRKFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.16
4 0.18
5 0.25
6 0.28
7 0.28
8 0.28
9 0.29
10 0.33
11 0.36
12 0.39
13 0.3
14 0.29
15 0.3
16 0.32
17 0.33
18 0.3
19 0.28
20 0.26
21 0.33
22 0.35
23 0.34
24 0.32
25 0.29
26 0.24
27 0.22
28 0.2
29 0.11
30 0.09
31 0.11
32 0.11
33 0.12
34 0.11
35 0.1
36 0.12
37 0.19
38 0.22
39 0.23
40 0.29
41 0.35
42 0.43
43 0.45
44 0.5
45 0.53
46 0.56
47 0.58
48 0.61
49 0.61
50 0.56
51 0.56
52 0.49
53 0.4
54 0.33
55 0.31
56 0.23
57 0.16
58 0.14
59 0.13
60 0.13
61 0.12
62 0.13
63 0.17
64 0.21
65 0.26
66 0.26
67 0.24
68 0.24
69 0.25
70 0.27
71 0.22
72 0.19
73 0.16
74 0.17
75 0.17
76 0.18
77 0.16
78 0.13
79 0.15
80 0.15
81 0.16
82 0.17
83 0.18
84 0.24
85 0.26
86 0.27
87 0.24
88 0.24
89 0.22
90 0.21
91 0.21
92 0.16
93 0.14
94 0.13
95 0.11
96 0.1
97 0.1
98 0.12
99 0.13
100 0.16
101 0.17
102 0.19
103 0.21
104 0.21
105 0.21
106 0.25
107 0.28
108 0.28
109 0.34
110 0.38
111 0.42
112 0.45
113 0.46
114 0.44
115 0.45
116 0.49
117 0.53
118 0.57
119 0.59
120 0.67
121 0.75
122 0.75
123 0.79
124 0.8
125 0.8
126 0.81
127 0.84
128 0.84
129 0.84
130 0.9
131 0.9
132 0.9
133 0.83
134 0.75
135 0.75
136 0.75
137 0.74
138 0.72
139 0.73
140 0.68
141 0.66
142 0.65
143 0.59
144 0.52
145 0.49
146 0.51
147 0.51