Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R4XFR5

Protein Details
Accession R4XFR5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MARGNQRDKAREKNLKKKETEBasic
NLS Segment(s)
PositionSequence
8-27DKAREKNLKKKETEAKGQKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR007513  SERF-like_N  
Pfam View protein in Pfam  
PF04419  4F5  
Amino Acid Sequences MARGNQRDKAREKNLKKKETEAKGQKKDGNAFKREQESNAEVCTVCCQVIGHDPDAPDNATKTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.79
4 0.78
5 0.77
6 0.73
7 0.74
8 0.74
9 0.74
10 0.72
11 0.75
12 0.69
13 0.63
14 0.63
15 0.61
16 0.58
17 0.51
18 0.46
19 0.44
20 0.46
21 0.43
22 0.37
23 0.33
24 0.29
25 0.26
26 0.25
27 0.22
28 0.17
29 0.17
30 0.17
31 0.13
32 0.1
33 0.09
34 0.09
35 0.09
36 0.17
37 0.2
38 0.19
39 0.21
40 0.22
41 0.23
42 0.25
43 0.25
44 0.19