Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R4XF53

Protein Details
Accession R4XF53    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAVKKKWSKGKVKDKANNAIMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAVKKKWSKGKVKDKANNAIMLDKNQYDKLFKEVGSYRFVSVSVLVDRLKINGSLARRALVELAEKGIIKEVELSHSQKIYTRALETEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.78
4 0.71
5 0.6
6 0.57
7 0.47
8 0.41
9 0.36
10 0.28
11 0.26
12 0.25
13 0.25
14 0.2
15 0.2
16 0.22
17 0.21
18 0.2
19 0.22
20 0.25
21 0.26
22 0.28
23 0.28
24 0.24
25 0.22
26 0.22
27 0.17
28 0.13
29 0.12
30 0.09
31 0.09
32 0.08
33 0.09
34 0.09
35 0.09
36 0.1
37 0.08
38 0.08
39 0.1
40 0.12
41 0.15
42 0.15
43 0.16
44 0.15
45 0.15
46 0.15
47 0.13
48 0.13
49 0.1
50 0.11
51 0.11
52 0.11
53 0.11
54 0.14
55 0.12
56 0.11
57 0.13
58 0.13
59 0.15
60 0.2
61 0.22
62 0.22
63 0.23
64 0.24
65 0.25
66 0.28
67 0.29
68 0.28
69 0.28