Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R4XKB5

Protein Details
Accession R4XKB5   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
25-59LSVNRLSTRPHEKKRKRKKKKKRHKTPQLTSPSLFBasic
NLS Segment(s)
PositionSequence
33-49RPHEKKRKRKKKKKRHK
Subcellular Location(s) mito 11, plas 9, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038584  L33_sf  
IPR001705  Ribosomal_L33  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00471  Ribosomal_L33  
Amino Acid Sequences MSWPQNIVYLVFHAPGTRGAQLFALSVNRLSTRPHEKKRKRKKKKKRHKTPQLTSPSLFWLLLLLRQDLLFVLIMAKKAKARNILVKLLSTAGTGFSYVRQRPRQAPYKLQMIKFDPRVNSRVMFEEQRLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.17
4 0.17
5 0.16
6 0.15
7 0.16
8 0.16
9 0.15
10 0.14
11 0.13
12 0.11
13 0.11
14 0.12
15 0.12
16 0.13
17 0.15
18 0.2
19 0.29
20 0.38
21 0.48
22 0.58
23 0.67
24 0.78
25 0.87
26 0.92
27 0.93
28 0.95
29 0.96
30 0.96
31 0.97
32 0.97
33 0.97
34 0.97
35 0.97
36 0.97
37 0.94
38 0.93
39 0.9
40 0.83
41 0.71
42 0.61
43 0.52
44 0.41
45 0.32
46 0.22
47 0.14
48 0.1
49 0.11
50 0.1
51 0.08
52 0.07
53 0.07
54 0.07
55 0.06
56 0.07
57 0.05
58 0.04
59 0.05
60 0.05
61 0.07
62 0.07
63 0.08
64 0.11
65 0.13
66 0.17
67 0.21
68 0.24
69 0.32
70 0.36
71 0.4
72 0.38
73 0.36
74 0.33
75 0.29
76 0.25
77 0.17
78 0.12
79 0.08
80 0.08
81 0.08
82 0.07
83 0.1
84 0.16
85 0.2
86 0.28
87 0.33
88 0.38
89 0.44
90 0.53
91 0.59
92 0.59
93 0.65
94 0.62
95 0.67
96 0.68
97 0.63
98 0.61
99 0.57
100 0.58
101 0.56
102 0.56
103 0.51
104 0.5
105 0.5
106 0.47
107 0.44
108 0.39
109 0.37
110 0.37
111 0.35
112 0.35