Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q59N79

Protein Details
Accession Q59N79    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
98-130ALSVLRKRRLKMKKHKYKKRRKAQRALRKRLGKBasic
NLS Segment(s)
PositionSequence
103-130RKRRLKMKKHKYKKRRKAQRALRKRLGK
Subcellular Location(s) mito 18, mito_nucl 13.666, cyto_mito 10.166, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Gene Ontology GO:0005739  C:mitochondrion  
KEGG cal:CAALFM_C503850WA  -  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MFRSILRFPSKISTGVSVFKQFASTTTTTTTINTVFARPSILASTSTTFNSSSPSLVSFFPYNRPTSTPVEFQPLSIEPKEYDLDTVDKDDDNNTMHALSVLRKRRLKMKKHKYKKRRKAQRALRKRLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.33
4 0.29
5 0.28
6 0.25
7 0.25
8 0.2
9 0.19
10 0.21
11 0.19
12 0.17
13 0.19
14 0.2
15 0.19
16 0.2
17 0.2
18 0.15
19 0.16
20 0.15
21 0.14
22 0.13
23 0.13
24 0.13
25 0.12
26 0.12
27 0.11
28 0.11
29 0.11
30 0.12
31 0.14
32 0.13
33 0.14
34 0.14
35 0.13
36 0.12
37 0.14
38 0.13
39 0.11
40 0.1
41 0.11
42 0.11
43 0.11
44 0.13
45 0.12
46 0.12
47 0.17
48 0.19
49 0.19
50 0.18
51 0.2
52 0.22
53 0.24
54 0.26
55 0.24
56 0.22
57 0.27
58 0.26
59 0.24
60 0.22
61 0.2
62 0.21
63 0.18
64 0.19
65 0.13
66 0.15
67 0.16
68 0.14
69 0.13
70 0.11
71 0.12
72 0.12
73 0.13
74 0.12
75 0.11
76 0.11
77 0.11
78 0.12
79 0.12
80 0.12
81 0.11
82 0.1
83 0.1
84 0.1
85 0.1
86 0.13
87 0.2
88 0.28
89 0.36
90 0.4
91 0.42
92 0.52
93 0.61
94 0.67
95 0.7
96 0.73
97 0.77
98 0.84
99 0.93
100 0.94
101 0.96
102 0.96
103 0.96
104 0.96
105 0.96
106 0.96
107 0.96
108 0.96
109 0.96
110 0.95