Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R4XH42

Protein Details
Accession R4XH42   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
3-23TQNEGRTKRGRPTIKKSNLFAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003195  TFIID_TAF13  
Gene Ontology GO:0005634  C:nucleus  
GO:0046982  F:protein heterodimerization activity  
GO:0006366  P:transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF02269  TFIID-18kDa  
CDD cd07978  TAF13  
Amino Acid Sequences MSTQNEGRTKRGRPTIKKSNLFAKDLKSMMYAFGDEDPTQDSINVMEDILTDFITELCTEAGRVAGPRQKVKVDDFKFVLRNDPKKLGRVEELLSLQKEIQQSRKLFDESAEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.77
3 0.8
4 0.82
5 0.78
6 0.78
7 0.73
8 0.67
9 0.61
10 0.54
11 0.49
12 0.42
13 0.38
14 0.3
15 0.25
16 0.22
17 0.19
18 0.15
19 0.1
20 0.11
21 0.13
22 0.11
23 0.11
24 0.12
25 0.12
26 0.11
27 0.1
28 0.09
29 0.07
30 0.09
31 0.08
32 0.07
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.08
52 0.11
53 0.14
54 0.17
55 0.19
56 0.21
57 0.24
58 0.28
59 0.36
60 0.35
61 0.37
62 0.37
63 0.39
64 0.4
65 0.38
66 0.42
67 0.4
68 0.43
69 0.43
70 0.49
71 0.47
72 0.49
73 0.51
74 0.47
75 0.43
76 0.4
77 0.37
78 0.33
79 0.34
80 0.33
81 0.31
82 0.28
83 0.24
84 0.24
85 0.26
86 0.26
87 0.3
88 0.34
89 0.35
90 0.37
91 0.42
92 0.41
93 0.38