Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R4XNJ3

Protein Details
Accession R4XNJ3    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
156-175LSQPRPKKEGQPPKKGQQTAHydrophilic
NLS Segment(s)
PositionSequence
162-163KK
Subcellular Location(s) nucl 23.5, mito_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003034  SAP_dom  
IPR036361  SAP_dom_sf  
Pfam View protein in Pfam  
PF02037  SAP  
PROSITE View protein in PROSITE  
PS50800  SAP  
Amino Acid Sequences MSNYEKLKNDDLKKILTDRGLPTTGKKADFVSRLVEHDATQSSTPATTKDPKVNQQRPAPAASETKVTNDGTSKTEEPNTKAKGEPTTTTPSTSTTQPTQEQVKSNDDREAKLAARAARFGIPKDEEEERRKARAARFGTSEAASTATTVPEDKALSQPRPKKEGQPPKKGQQTAAATAAATGKKESEVQKRKVSVLDDPVEAEKARKRALKFGTAGVSAPAVEGKELPPAAEVASTTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.48
3 0.43
4 0.42
5 0.37
6 0.4
7 0.39
8 0.36
9 0.36
10 0.4
11 0.41
12 0.37
13 0.35
14 0.32
15 0.36
16 0.38
17 0.36
18 0.33
19 0.31
20 0.32
21 0.34
22 0.31
23 0.25
24 0.25
25 0.25
26 0.21
27 0.19
28 0.17
29 0.14
30 0.14
31 0.14
32 0.13
33 0.17
34 0.21
35 0.26
36 0.34
37 0.39
38 0.47
39 0.58
40 0.63
41 0.66
42 0.66
43 0.69
44 0.63
45 0.6
46 0.53
47 0.45
48 0.4
49 0.34
50 0.29
51 0.23
52 0.22
53 0.22
54 0.21
55 0.19
56 0.18
57 0.19
58 0.17
59 0.21
60 0.2
61 0.2
62 0.25
63 0.26
64 0.28
65 0.34
66 0.35
67 0.32
68 0.32
69 0.33
70 0.32
71 0.32
72 0.3
73 0.27
74 0.31
75 0.3
76 0.3
77 0.28
78 0.26
79 0.25
80 0.26
81 0.24
82 0.19
83 0.22
84 0.22
85 0.25
86 0.26
87 0.27
88 0.29
89 0.29
90 0.34
91 0.33
92 0.33
93 0.36
94 0.32
95 0.3
96 0.27
97 0.27
98 0.2
99 0.19
100 0.2
101 0.17
102 0.16
103 0.16
104 0.15
105 0.16
106 0.17
107 0.16
108 0.16
109 0.15
110 0.15
111 0.18
112 0.21
113 0.22
114 0.26
115 0.33
116 0.31
117 0.32
118 0.33
119 0.35
120 0.35
121 0.38
122 0.38
123 0.34
124 0.35
125 0.35
126 0.35
127 0.3
128 0.27
129 0.19
130 0.16
131 0.13
132 0.11
133 0.09
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.08
140 0.08
141 0.14
142 0.19
143 0.24
144 0.31
145 0.38
146 0.42
147 0.47
148 0.48
149 0.51
150 0.57
151 0.64
152 0.66
153 0.7
154 0.72
155 0.75
156 0.82
157 0.74
158 0.65
159 0.63
160 0.58
161 0.5
162 0.45
163 0.36
164 0.27
165 0.26
166 0.28
167 0.19
168 0.15
169 0.12
170 0.1
171 0.11
172 0.16
173 0.22
174 0.3
175 0.39
176 0.45
177 0.52
178 0.55
179 0.56
180 0.55
181 0.51
182 0.46
183 0.44
184 0.41
185 0.34
186 0.33
187 0.32
188 0.3
189 0.27
190 0.24
191 0.21
192 0.23
193 0.28
194 0.32
195 0.33
196 0.4
197 0.46
198 0.51
199 0.48
200 0.48
201 0.47
202 0.42
203 0.4
204 0.32
205 0.27
206 0.19
207 0.17
208 0.13
209 0.09
210 0.09
211 0.09
212 0.09
213 0.15
214 0.15
215 0.15
216 0.14
217 0.15
218 0.15
219 0.14