Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R4XGU4

Protein Details
Accession R4XGU4    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-34VNIPKTRKTYCKGKDCRKHTQHKVTQYKKGRDSHydrophilic
NLS Segment(s)
PositionSequence
40-63KRRYDRKQKGYGGQTKPVFHKKAK
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRKTYCKGKDCRKHTQHKVTQYKKGRDSLFAQGKRRYDRKQKGYGGQTKPVFHKKAKTTKKVVLRLECVSCKYKMQISLKRCKHFELGGDKKTKGAALTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.83
4 0.88
5 0.87
6 0.88
7 0.88
8 0.88
9 0.85
10 0.86
11 0.89
12 0.85
13 0.85
14 0.84
15 0.82
16 0.76
17 0.75
18 0.66
19 0.59
20 0.56
21 0.56
22 0.56
23 0.53
24 0.53
25 0.51
26 0.54
27 0.57
28 0.59
29 0.57
30 0.58
31 0.63
32 0.65
33 0.7
34 0.7
35 0.71
36 0.73
37 0.74
38 0.66
39 0.64
40 0.58
41 0.51
42 0.5
43 0.5
44 0.45
45 0.38
46 0.42
47 0.43
48 0.51
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.66
57 0.61
58 0.57
59 0.55
60 0.5
61 0.44
62 0.39
63 0.34
64 0.3
65 0.28
66 0.28
67 0.31
68 0.38
69 0.43
70 0.48
71 0.58
72 0.65
73 0.7
74 0.67
75 0.63
76 0.59
77 0.53
78 0.53
79 0.53
80 0.53
81 0.54
82 0.57
83 0.54
84 0.5
85 0.48
86 0.42