Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RJT8

Protein Details
Accession F4RJT8    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-118NQVHKAQTKHEHQRRKNKLEQTGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 15.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
IPR042225  Ncb2  
Gene Ontology GO:0017054  C:negative cofactor 2 complex  
GO:0003682  F:chromatin binding  
GO:0001046  F:core promoter sequence-specific DNA binding  
GO:0140223  F:general transcription initiation factor activity  
GO:0046982  F:protein heterodimerization activity  
GO:0017025  F:TBP-class protein binding  
GO:0003713  F:transcription coactivator activity  
GO:0003714  F:transcription corepressor activity  
GO:0017055  P:negative regulation of RNA polymerase II transcription preinitiation complex assembly  
GO:0016480  P:negative regulation of transcription by RNA polymerase III  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0051123  P:RNA polymerase II preinitiation complex assembly  
KEGG mlr:MELLADRAFT_35580  -  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MSDNERGITDGEDISLPRATVNKVIQEFLPNEIVCSKDTKDLIADCCKEFITLISSEANEICERDSKKTISPEHITSALKQLGFDEYIEEVESVNQVHKAQTKHEHQRRKNKLEQTGLSQDELAAQQELLFAESKARFDAGQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.11
4 0.11
5 0.13
6 0.14
7 0.19
8 0.22
9 0.26
10 0.26
11 0.28
12 0.27
13 0.3
14 0.29
15 0.26
16 0.28
17 0.21
18 0.2
19 0.2
20 0.21
21 0.17
22 0.19
23 0.17
24 0.17
25 0.18
26 0.18
27 0.19
28 0.2
29 0.24
30 0.28
31 0.29
32 0.24
33 0.25
34 0.24
35 0.21
36 0.19
37 0.15
38 0.12
39 0.1
40 0.11
41 0.11
42 0.1
43 0.11
44 0.11
45 0.11
46 0.08
47 0.08
48 0.08
49 0.12
50 0.13
51 0.16
52 0.19
53 0.19
54 0.23
55 0.29
56 0.3
57 0.31
58 0.33
59 0.31
60 0.31
61 0.33
62 0.29
63 0.24
64 0.26
65 0.22
66 0.18
67 0.16
68 0.15
69 0.13
70 0.13
71 0.12
72 0.09
73 0.07
74 0.08
75 0.08
76 0.08
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.07
83 0.07
84 0.09
85 0.14
86 0.15
87 0.2
88 0.28
89 0.37
90 0.47
91 0.55
92 0.64
93 0.69
94 0.79
95 0.84
96 0.84
97 0.84
98 0.81
99 0.81
100 0.79
101 0.73
102 0.69
103 0.66
104 0.59
105 0.51
106 0.43
107 0.34
108 0.27
109 0.25
110 0.18
111 0.11
112 0.09
113 0.08
114 0.09
115 0.1
116 0.09
117 0.09
118 0.08
119 0.14
120 0.15
121 0.16
122 0.16
123 0.17