Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R4XC29

Protein Details
Accession R4XC29   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
186-211TPPQDNKSSEKKKSWGKRLSFGKNKAHydrophilic
NLS Segment(s)
PositionSequence
196-210KKKSWGKRLSFGKNK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018809  DUF2406  
Pfam View protein in Pfam  
PF10295  DUF2406  
Amino Acid Sequences MPPMPGNEKANPNIAMNEANGFEQWQGMAIDYTPYLSKDVYGHPIAEPDLSNPTRSRHERPLDTIRAFEAAAYGKEYTVGGDAASEMGLQRGNSRQSLAQYDNRRPFNRNSSTSGNGNMPRHYSYGNMQDQFEDDGASEIQGGPSRETPLTPRAYNEHQQPSASSWETRNQGYAPPQKLTYQTPPTPPQDNKSSEKKKSWGKRLSFGKNKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.27
3 0.22
4 0.21
5 0.17
6 0.15
7 0.14
8 0.13
9 0.11
10 0.1
11 0.09
12 0.08
13 0.08
14 0.08
15 0.08
16 0.08
17 0.09
18 0.08
19 0.1
20 0.09
21 0.09
22 0.1
23 0.1
24 0.11
25 0.12
26 0.15
27 0.19
28 0.2
29 0.2
30 0.19
31 0.21
32 0.2
33 0.19
34 0.16
35 0.12
36 0.18
37 0.18
38 0.2
39 0.2
40 0.23
41 0.3
42 0.35
43 0.4
44 0.42
45 0.49
46 0.51
47 0.57
48 0.62
49 0.62
50 0.57
51 0.51
52 0.42
53 0.35
54 0.31
55 0.24
56 0.16
57 0.1
58 0.09
59 0.1
60 0.1
61 0.08
62 0.09
63 0.09
64 0.08
65 0.07
66 0.07
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.04
73 0.03
74 0.04
75 0.05
76 0.05
77 0.06
78 0.09
79 0.11
80 0.11
81 0.13
82 0.14
83 0.15
84 0.19
85 0.21
86 0.25
87 0.28
88 0.35
89 0.41
90 0.45
91 0.45
92 0.44
93 0.45
94 0.47
95 0.49
96 0.44
97 0.43
98 0.42
99 0.44
100 0.41
101 0.39
102 0.34
103 0.31
104 0.3
105 0.25
106 0.23
107 0.21
108 0.21
109 0.2
110 0.18
111 0.16
112 0.23
113 0.27
114 0.26
115 0.25
116 0.24
117 0.24
118 0.24
119 0.21
120 0.12
121 0.08
122 0.07
123 0.07
124 0.07
125 0.06
126 0.05
127 0.06
128 0.08
129 0.09
130 0.1
131 0.11
132 0.14
133 0.14
134 0.14
135 0.17
136 0.21
137 0.25
138 0.24
139 0.25
140 0.28
141 0.34
142 0.38
143 0.43
144 0.44
145 0.4
146 0.4
147 0.39
148 0.37
149 0.36
150 0.33
151 0.27
152 0.22
153 0.27
154 0.3
155 0.29
156 0.29
157 0.24
158 0.26
159 0.33
160 0.4
161 0.37
162 0.37
163 0.38
164 0.38
165 0.41
166 0.43
167 0.43
168 0.43
169 0.44
170 0.48
171 0.53
172 0.56
173 0.61
174 0.58
175 0.55
176 0.55
177 0.57
178 0.56
179 0.61
180 0.65
181 0.65
182 0.69
183 0.71
184 0.73
185 0.77
186 0.81
187 0.8
188 0.77
189 0.79
190 0.82
191 0.85