Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P0CB63

Protein Details
Accession P0CB63   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
11-33LSAEEKKRLLRERRQAKMSKGKAHydrophilic
NLS Segment(s)
PositionSequence
16-32KKRLLRERRQAKMSKGK
Subcellular Location(s) cyto 12, cyto_nucl 10.5, nucl 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014802  GET2  
IPR028143  Get2/sif1  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0043529  C:GET complex  
GO:0000139  C:Golgi membrane  
GO:0045048  P:protein insertion into ER membrane  
GO:0006890  P:retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum  
KEGG cal:CAALFM_C109750WA  -  
Pfam View protein in Pfam  
PF08690  GET2  
Amino Acid Sequences MSEPVVDTAELSAEEKKRLLRERRQAKMSKGKATARLNDILSQGSSVKTSGVKSVLDQEKEATPSHDEDPEIQDITEITTPPPRTPPIGEDAPQDIDKIFQSMLQQQGQGADTAGDPFAQIMKMFNQVEGGDSPPSESATSTQDPAELKYRQELLEYNTYNQKLWKFRFLLVRVSVTLFNFFYHYINLSNFHASNYAYVRDLSSEKYPVRDFFTWFATTEVVLVAAYYSIFHSLGLFHAANQNSFVLKAMSMGSMVLPQLEHYKPLVARFLGYYELLGIVLGDLSLVIVLFGLLSFAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.25
4 0.32
5 0.41
6 0.5
7 0.54
8 0.63
9 0.71
10 0.78
11 0.83
12 0.82
13 0.82
14 0.83
15 0.8
16 0.78
17 0.75
18 0.72
19 0.72
20 0.72
21 0.69
22 0.63
23 0.6
24 0.53
25 0.48
26 0.43
27 0.36
28 0.29
29 0.24
30 0.19
31 0.15
32 0.14
33 0.11
34 0.12
35 0.12
36 0.13
37 0.15
38 0.16
39 0.16
40 0.17
41 0.26
42 0.31
43 0.3
44 0.3
45 0.29
46 0.3
47 0.31
48 0.31
49 0.23
50 0.19
51 0.21
52 0.22
53 0.22
54 0.2
55 0.2
56 0.23
57 0.23
58 0.21
59 0.18
60 0.16
61 0.14
62 0.15
63 0.15
64 0.11
65 0.1
66 0.16
67 0.17
68 0.18
69 0.22
70 0.21
71 0.22
72 0.24
73 0.26
74 0.26
75 0.28
76 0.28
77 0.27
78 0.27
79 0.27
80 0.25
81 0.23
82 0.17
83 0.14
84 0.13
85 0.12
86 0.1
87 0.08
88 0.1
89 0.14
90 0.18
91 0.18
92 0.18
93 0.17
94 0.18
95 0.17
96 0.15
97 0.11
98 0.08
99 0.07
100 0.07
101 0.07
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.07
110 0.12
111 0.12
112 0.12
113 0.13
114 0.12
115 0.14
116 0.13
117 0.14
118 0.08
119 0.08
120 0.09
121 0.08
122 0.09
123 0.07
124 0.07
125 0.07
126 0.11
127 0.12
128 0.12
129 0.12
130 0.13
131 0.14
132 0.15
133 0.19
134 0.16
135 0.15
136 0.17
137 0.18
138 0.16
139 0.17
140 0.17
141 0.15
142 0.22
143 0.22
144 0.22
145 0.24
146 0.25
147 0.24
148 0.25
149 0.26
150 0.25
151 0.27
152 0.32
153 0.3
154 0.33
155 0.41
156 0.4
157 0.42
158 0.37
159 0.37
160 0.3
161 0.29
162 0.27
163 0.19
164 0.19
165 0.14
166 0.12
167 0.11
168 0.12
169 0.11
170 0.1
171 0.11
172 0.1
173 0.11
174 0.13
175 0.13
176 0.15
177 0.14
178 0.14
179 0.14
180 0.13
181 0.14
182 0.14
183 0.14
184 0.12
185 0.12
186 0.12
187 0.13
188 0.13
189 0.14
190 0.15
191 0.19
192 0.18
193 0.22
194 0.24
195 0.24
196 0.29
197 0.28
198 0.28
199 0.26
200 0.29
201 0.27
202 0.25
203 0.25
204 0.18
205 0.17
206 0.14
207 0.12
208 0.07
209 0.06
210 0.05
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.05
217 0.06
218 0.06
219 0.06
220 0.06
221 0.07
222 0.12
223 0.11
224 0.1
225 0.16
226 0.17
227 0.17
228 0.18
229 0.18
230 0.14
231 0.14
232 0.15
233 0.1
234 0.09
235 0.1
236 0.09
237 0.08
238 0.08
239 0.08
240 0.08
241 0.08
242 0.08
243 0.07
244 0.06
245 0.07
246 0.13
247 0.13
248 0.15
249 0.15
250 0.2
251 0.21
252 0.24
253 0.28
254 0.23
255 0.24
256 0.23
257 0.24
258 0.21
259 0.19
260 0.17
261 0.12
262 0.12
263 0.1
264 0.09
265 0.07
266 0.05
267 0.05
268 0.04
269 0.03
270 0.03
271 0.03
272 0.03
273 0.03
274 0.03
275 0.02
276 0.03
277 0.03
278 0.03