Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R4XA49

Protein Details
Accession R4XA49    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPSKNSVNRPKNKNTARAKAQHKSHydrophilic
36-56IRGKVDSKKVQQKKLRRTRLAHydrophilic
NLS Segment(s)
PositionSequence
9-53RPKNKNTARAKAQHKSAVARRKPQTAIIRGKVDSKKVQQKKLRRT
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
Amino Acid Sequences MPSKNSVNRPKNKNTARAKAQHKSAVARRKPQTAIIRGKVDSKKVQQKKLRRTRLASALDKDSDAADEEDDVMLDEEEAKVLDKIDTKARKEAKRAAMLEEQEESKNEAAEKVFKMDSTTGKGTTLGGPSPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.8
4 0.81
5 0.81
6 0.77
7 0.76
8 0.73
9 0.66
10 0.64
11 0.63
12 0.65
13 0.62
14 0.64
15 0.62
16 0.62
17 0.61
18 0.61
19 0.62
20 0.6
21 0.62
22 0.59
23 0.58
24 0.52
25 0.58
26 0.53
27 0.49
28 0.46
29 0.46
30 0.5
31 0.54
32 0.62
33 0.63
34 0.7
35 0.76
36 0.81
37 0.83
38 0.79
39 0.77
40 0.73
41 0.74
42 0.72
43 0.65
44 0.57
45 0.49
46 0.43
47 0.38
48 0.32
49 0.22
50 0.15
51 0.12
52 0.09
53 0.06
54 0.05
55 0.06
56 0.05
57 0.05
58 0.05
59 0.04
60 0.03
61 0.03
62 0.04
63 0.03
64 0.03
65 0.04
66 0.04
67 0.04
68 0.05
69 0.06
70 0.08
71 0.1
72 0.18
73 0.24
74 0.26
75 0.34
76 0.42
77 0.45
78 0.49
79 0.56
80 0.56
81 0.58
82 0.57
83 0.54
84 0.52
85 0.48
86 0.44
87 0.37
88 0.31
89 0.24
90 0.23
91 0.21
92 0.16
93 0.16
94 0.14
95 0.14
96 0.14
97 0.18
98 0.18
99 0.2
100 0.2
101 0.19
102 0.22
103 0.24
104 0.26
105 0.28
106 0.3
107 0.26
108 0.27
109 0.27
110 0.25
111 0.25
112 0.24