Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R4XD00

Protein Details
Accession R4XD00   
Localization Confidence High
Confidence Score 19.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPKDTKPRTVKRDVTKRAKKDPDAPKRABasic
96-115NPKAGKTKGAAKKTAKKSKSHydrophilic
NLS Segment(s)
PositionSequence
11-21KRDVTKRAKKD
82-90KKKYEKAKA
95-114ENPKAGKTKGAAKKTAKKSK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKDTKPRTVKRDVTKRAKKDPDAPKRALSSYMLFAQDQRSVVQQEHPNIAFGEVGKVLGQKWKALTDSEKKPYEDRAAEEKKKYEKAKAQYEVENPKAGKTKGAAKKTAKKSKSDDDESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.87
4 0.87
5 0.87
6 0.82
7 0.81
8 0.81
9 0.81
10 0.79
11 0.74
12 0.69
13 0.63
14 0.59
15 0.51
16 0.43
17 0.34
18 0.29
19 0.28
20 0.24
21 0.21
22 0.2
23 0.21
24 0.2
25 0.18
26 0.16
27 0.15
28 0.15
29 0.15
30 0.21
31 0.22
32 0.23
33 0.26
34 0.25
35 0.24
36 0.22
37 0.22
38 0.16
39 0.12
40 0.11
41 0.07
42 0.07
43 0.06
44 0.06
45 0.06
46 0.09
47 0.09
48 0.09
49 0.1
50 0.11
51 0.12
52 0.13
53 0.18
54 0.23
55 0.29
56 0.35
57 0.37
58 0.37
59 0.38
60 0.4
61 0.41
62 0.35
63 0.32
64 0.35
65 0.41
66 0.45
67 0.47
68 0.48
69 0.48
70 0.54
71 0.53
72 0.51
73 0.51
74 0.54
75 0.61
76 0.63
77 0.61
78 0.59
79 0.63
80 0.63
81 0.57
82 0.54
83 0.45
84 0.41
85 0.44
86 0.38
87 0.34
88 0.29
89 0.37
90 0.41
91 0.47
92 0.52
93 0.55
94 0.65
95 0.73
96 0.81
97 0.75
98 0.73
99 0.74
100 0.76
101 0.77