Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S290

Protein Details
Accession F4S290   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
115-135IAPVLKAKRRLRKRGWYNTLSHydrophilic
NLS Segment(s)
PositionSequence
121-128AKRRLRKR
Subcellular Location(s) nucl 6.5, plas 6, cyto_nucl 5.5, cyto 3.5, mito 3, pero 3, golg 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mlr:MELLADRAFT_73039  -  
Amino Acid Sequences MPQELLSFPPIYLLVGIYRLTTDPKLWYPIWKDCKSTIKSTILISIGTSIITLPLTNLWVKFFMNSTSLLRYTEESFFWKLSVQRIAVFSIWIGQLKSRNKPNSFWAEYFEEWEIAPVLKAKRRLRKRGWYNTLSGPFVRFFVLKVLLIPLHFVPFLNTIIISLLSSLTFSETQLAPYFKSKKMTDLQTSIFITERERELRLLGFIGCLLQRIPLIGMIFSISNRIGIAMYAHDLEKRQELFRKGILKPKGAYQSRTALVELDLPRDAIGNFPKKEALEEEEEEEVSEKKLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.1
5 0.11
6 0.11
7 0.15
8 0.15
9 0.17
10 0.2
11 0.22
12 0.28
13 0.28
14 0.34
15 0.37
16 0.46
17 0.53
18 0.52
19 0.53
20 0.54
21 0.62
22 0.6
23 0.59
24 0.57
25 0.52
26 0.51
27 0.48
28 0.46
29 0.37
30 0.33
31 0.26
32 0.21
33 0.15
34 0.13
35 0.12
36 0.07
37 0.07
38 0.07
39 0.06
40 0.05
41 0.06
42 0.08
43 0.1
44 0.1
45 0.11
46 0.12
47 0.13
48 0.13
49 0.14
50 0.13
51 0.13
52 0.15
53 0.16
54 0.18
55 0.19
56 0.19
57 0.19
58 0.19
59 0.21
60 0.2
61 0.19
62 0.19
63 0.2
64 0.2
65 0.19
66 0.19
67 0.18
68 0.21
69 0.24
70 0.21
71 0.21
72 0.22
73 0.24
74 0.21
75 0.19
76 0.15
77 0.13
78 0.12
79 0.11
80 0.1
81 0.1
82 0.17
83 0.22
84 0.29
85 0.35
86 0.43
87 0.44
88 0.46
89 0.52
90 0.54
91 0.54
92 0.48
93 0.43
94 0.4
95 0.37
96 0.37
97 0.31
98 0.22
99 0.17
100 0.17
101 0.13
102 0.08
103 0.08
104 0.09
105 0.11
106 0.14
107 0.23
108 0.3
109 0.39
110 0.49
111 0.59
112 0.64
113 0.72
114 0.79
115 0.82
116 0.83
117 0.76
118 0.71
119 0.67
120 0.61
121 0.51
122 0.41
123 0.31
124 0.23
125 0.2
126 0.18
127 0.11
128 0.09
129 0.1
130 0.11
131 0.09
132 0.09
133 0.09
134 0.09
135 0.09
136 0.09
137 0.07
138 0.07
139 0.07
140 0.07
141 0.07
142 0.08
143 0.09
144 0.08
145 0.08
146 0.07
147 0.07
148 0.07
149 0.06
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.05
156 0.06
157 0.06
158 0.08
159 0.08
160 0.1
161 0.12
162 0.13
163 0.12
164 0.18
165 0.22
166 0.22
167 0.28
168 0.27
169 0.31
170 0.36
171 0.41
172 0.4
173 0.4
174 0.39
175 0.38
176 0.38
177 0.33
178 0.27
179 0.21
180 0.18
181 0.16
182 0.17
183 0.15
184 0.16
185 0.16
186 0.16
187 0.17
188 0.16
189 0.14
190 0.12
191 0.09
192 0.08
193 0.09
194 0.08
195 0.07
196 0.07
197 0.07
198 0.07
199 0.07
200 0.07
201 0.08
202 0.09
203 0.08
204 0.08
205 0.08
206 0.08
207 0.08
208 0.09
209 0.07
210 0.07
211 0.07
212 0.08
213 0.07
214 0.07
215 0.08
216 0.07
217 0.08
218 0.09
219 0.09
220 0.1
221 0.11
222 0.13
223 0.17
224 0.19
225 0.22
226 0.28
227 0.31
228 0.34
229 0.39
230 0.45
231 0.43
232 0.49
233 0.51
234 0.49
235 0.47
236 0.51
237 0.55
238 0.52
239 0.52
240 0.48
241 0.5
242 0.46
243 0.47
244 0.39
245 0.3
246 0.26
247 0.3
248 0.26
249 0.22
250 0.2
251 0.18
252 0.18
253 0.18
254 0.18
255 0.16
256 0.23
257 0.29
258 0.29
259 0.31
260 0.34
261 0.33
262 0.36
263 0.35
264 0.32
265 0.3
266 0.31
267 0.32
268 0.31
269 0.3
270 0.28
271 0.25
272 0.21