Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R4X7W7

Protein Details
Accession R4X7W7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-40GASTKAGGIKKKKKRNLDSNDSTRMSHydrophilic
NLS Segment(s)
PositionSequence
12-29KFKGASTKAGGIKKKKKR
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MDYKSVNSKSLKFKGASTKAGGIKKKKKRNLDSNDSTRMSSSTEPSKLVESDPTTSDKDGSARPSIDTRTPAQRKFDEIRRIRQEKEIEKTASMSHRERIEAMNTHLSKLTDVNDLPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.55
4 0.49
5 0.5
6 0.5
7 0.56
8 0.58
9 0.57
10 0.62
11 0.68
12 0.74
13 0.76
14 0.8
15 0.83
16 0.87
17 0.87
18 0.87
19 0.86
20 0.83
21 0.82
22 0.72
23 0.62
24 0.51
25 0.42
26 0.34
27 0.26
28 0.22
29 0.2
30 0.2
31 0.2
32 0.21
33 0.22
34 0.2
35 0.19
36 0.19
37 0.16
38 0.16
39 0.16
40 0.18
41 0.18
42 0.17
43 0.17
44 0.14
45 0.14
46 0.14
47 0.15
48 0.14
49 0.14
50 0.14
51 0.16
52 0.17
53 0.18
54 0.19
55 0.18
56 0.27
57 0.32
58 0.33
59 0.37
60 0.36
61 0.4
62 0.43
63 0.49
64 0.49
65 0.48
66 0.55
67 0.6
68 0.62
69 0.58
70 0.6
71 0.59
72 0.56
73 0.58
74 0.55
75 0.47
76 0.44
77 0.43
78 0.39
79 0.37
80 0.35
81 0.31
82 0.29
83 0.3
84 0.31
85 0.31
86 0.3
87 0.3
88 0.29
89 0.31
90 0.36
91 0.34
92 0.34
93 0.35
94 0.32
95 0.28
96 0.27
97 0.24
98 0.2
99 0.2
100 0.24
101 0.25
102 0.26