Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R4XFW1

Protein Details
Accession R4XFW1    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-42AKSTTSGDKKKRQSVRKETYSSHydrophilic
NLS Segment(s)
PositionSequence
5-33PPPRHTAKAPAEKKVAAKSTTSGDKKKRQ
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
GO:0006325  P:chromatin organization  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences QRRSPPPRHTAKAPAEKKVAAKSTTSGDKKKRQSVRKETYSSYIYKVLKQVHPDTGISGKAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYSSSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.65
3 0.62
4 0.6
5 0.57
6 0.52
7 0.43
8 0.4
9 0.35
10 0.36
11 0.42
12 0.44
13 0.45
14 0.48
15 0.56
16 0.62
17 0.7
18 0.74
19 0.74
20 0.79
21 0.82
22 0.83
23 0.83
24 0.79
25 0.72
26 0.67
27 0.61
28 0.52
29 0.44
30 0.41
31 0.32
32 0.3
33 0.32
34 0.32
35 0.32
36 0.35
37 0.35
38 0.32
39 0.33
40 0.31
41 0.27
42 0.24
43 0.21
44 0.16
45 0.13
46 0.09
47 0.09
48 0.09
49 0.08
50 0.07
51 0.07
52 0.07
53 0.08
54 0.08
55 0.06
56 0.08
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.07
63 0.07
64 0.06
65 0.07
66 0.07
67 0.07
68 0.08
69 0.07
70 0.11
71 0.16
72 0.19
73 0.22
74 0.24
75 0.26
76 0.27
77 0.29
78 0.31
79 0.31
80 0.33
81 0.32
82 0.34
83 0.32
84 0.32
85 0.31
86 0.27
87 0.22
88 0.18
89 0.16
90 0.12
91 0.12
92 0.12
93 0.1
94 0.09
95 0.09
96 0.1
97 0.1
98 0.1
99 0.09
100 0.1
101 0.1
102 0.11
103 0.11
104 0.13
105 0.16
106 0.16
107 0.18
108 0.18
109 0.19