Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5EEY7

Protein Details
Accession M5EEY7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
289-309RGYCRLEKPEMKKRIKKDGLVBasic
NLS Segment(s)
Subcellular Location(s) plas 14, E.R. 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027434  Homing_endonucl  
IPR004860  LAGLIDADG_2  
IPR003945  NU5C-like  
IPR001516  Proton_antipo_N  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
GO:0004519  F:endonuclease activity  
GO:0008137  F:NADH dehydrogenase (ubiquinone) activity  
GO:0042773  P:ATP synthesis coupled electron transport  
Pfam View protein in Pfam  
PF03161  LAGLIDADG_2  
PF00662  Proton_antipo_N  
Amino Acid Sequences YIRANLCYIYNSNSRSRISYWIRNISSILPIKRNNSNSIIMYLAIITLPLLSAISAGLLGRKLGVTGAQLITSGSVIITCFLALIAFYEVGLTISPVSIKLFSWIDSESLTIDWGFNFDALTVSMLIPVLIVSALVHVYSIGYMSEDPHQQRFFSYLSMFTFFMLILVTGDNYLVMFIGWEGELSCLKWLNINNLDSLSLCEIISPFLCPLIKKSNEKSSEVKNELTKLRSYQRIGPHNIDILSILIGSLLGDGHMEKRGQGLGVRVKFEQSSKNVEYLMWFHSYLSTRGYCRLEKPEMKKRIKKDGLVIYHYLVNSYTFTSLNWLHDMFYLHNVQTNKLKKTIPLNLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.41
4 0.45
5 0.47
6 0.52
7 0.55
8 0.6
9 0.59
10 0.57
11 0.56
12 0.48
13 0.48
14 0.46
15 0.42
16 0.39
17 0.42
18 0.46
19 0.53
20 0.55
21 0.52
22 0.49
23 0.49
24 0.43
25 0.41
26 0.37
27 0.28
28 0.24
29 0.19
30 0.14
31 0.09
32 0.07
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.03
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.05
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.08
52 0.07
53 0.11
54 0.11
55 0.11
56 0.11
57 0.11
58 0.11
59 0.1
60 0.08
61 0.05
62 0.04
63 0.04
64 0.05
65 0.05
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.06
73 0.05
74 0.05
75 0.05
76 0.06
77 0.06
78 0.06
79 0.05
80 0.04
81 0.04
82 0.05
83 0.05
84 0.06
85 0.06
86 0.07
87 0.1
88 0.1
89 0.11
90 0.13
91 0.13
92 0.13
93 0.12
94 0.12
95 0.1
96 0.09
97 0.09
98 0.07
99 0.07
100 0.06
101 0.06
102 0.06
103 0.06
104 0.05
105 0.05
106 0.05
107 0.05
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.05
114 0.05
115 0.04
116 0.04
117 0.03
118 0.03
119 0.02
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.04
131 0.05
132 0.08
133 0.12
134 0.13
135 0.17
136 0.18
137 0.17
138 0.18
139 0.19
140 0.17
141 0.15
142 0.14
143 0.12
144 0.13
145 0.15
146 0.14
147 0.12
148 0.12
149 0.1
150 0.09
151 0.07
152 0.06
153 0.04
154 0.04
155 0.04
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.02
162 0.02
163 0.02
164 0.02
165 0.03
166 0.03
167 0.03
168 0.03
169 0.04
170 0.04
171 0.05
172 0.05
173 0.06
174 0.06
175 0.09
176 0.1
177 0.15
178 0.19
179 0.19
180 0.19
181 0.19
182 0.19
183 0.16
184 0.16
185 0.11
186 0.08
187 0.07
188 0.07
189 0.07
190 0.07
191 0.07
192 0.07
193 0.06
194 0.07
195 0.08
196 0.08
197 0.12
198 0.2
199 0.24
200 0.29
201 0.34
202 0.41
203 0.44
204 0.48
205 0.48
206 0.47
207 0.51
208 0.49
209 0.47
210 0.4
211 0.42
212 0.41
213 0.39
214 0.33
215 0.29
216 0.32
217 0.35
218 0.35
219 0.37
220 0.42
221 0.48
222 0.51
223 0.5
224 0.47
225 0.43
226 0.4
227 0.34
228 0.25
229 0.18
230 0.13
231 0.09
232 0.07
233 0.04
234 0.04
235 0.04
236 0.03
237 0.03
238 0.03
239 0.03
240 0.04
241 0.05
242 0.08
243 0.08
244 0.08
245 0.1
246 0.1
247 0.11
248 0.12
249 0.17
250 0.23
251 0.26
252 0.28
253 0.27
254 0.28
255 0.29
256 0.3
257 0.3
258 0.26
259 0.31
260 0.31
261 0.32
262 0.31
263 0.29
264 0.29
265 0.25
266 0.24
267 0.18
268 0.17
269 0.15
270 0.19
271 0.21
272 0.2
273 0.22
274 0.22
275 0.21
276 0.27
277 0.32
278 0.3
279 0.34
280 0.4
281 0.45
282 0.51
283 0.58
284 0.63
285 0.69
286 0.76
287 0.79
288 0.79
289 0.81
290 0.8
291 0.76
292 0.74
293 0.73
294 0.7
295 0.67
296 0.62
297 0.53
298 0.48
299 0.43
300 0.35
301 0.25
302 0.2
303 0.16
304 0.15
305 0.15
306 0.12
307 0.12
308 0.17
309 0.19
310 0.2
311 0.22
312 0.21
313 0.2
314 0.22
315 0.25
316 0.21
317 0.24
318 0.24
319 0.21
320 0.26
321 0.26
322 0.28
323 0.35
324 0.41
325 0.4
326 0.42
327 0.44
328 0.45
329 0.53