Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S0BE56

Protein Details
Accession S0BE56    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
110-131TKVTEKTRKKLIHNPPRKFAVKHydrophilic
NLS Segment(s)
PositionSequence
93-130RVKQTRAIRRKLTKHEATKVTEKTRKKLIHNPPRKFAV
Subcellular Location(s) nucl 23, cyto_nucl 13.833, mito_nucl 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAGAKEQETDGSEIAAHTLRSQNKAELMKQLEELKQELASLRVQKIAGGASSKVTKIHDVRKNIARVLTVINHAQREAVRDHYKGKRTPLDLRVKQTRAIRRKLTKHEATKVTEKTRKKLIHNPPRKFAVKASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.1
4 0.1
5 0.17
6 0.19
7 0.24
8 0.26
9 0.27
10 0.32
11 0.35
12 0.35
13 0.36
14 0.37
15 0.34
16 0.35
17 0.36
18 0.32
19 0.3
20 0.29
21 0.23
22 0.19
23 0.18
24 0.15
25 0.13
26 0.15
27 0.16
28 0.16
29 0.17
30 0.17
31 0.16
32 0.17
33 0.15
34 0.13
35 0.11
36 0.1
37 0.1
38 0.12
39 0.12
40 0.12
41 0.12
42 0.16
43 0.19
44 0.28
45 0.32
46 0.35
47 0.4
48 0.45
49 0.46
50 0.42
51 0.39
52 0.3
53 0.25
54 0.23
55 0.19
56 0.14
57 0.15
58 0.15
59 0.14
60 0.14
61 0.14
62 0.12
63 0.14
64 0.13
65 0.18
66 0.19
67 0.21
68 0.27
69 0.33
70 0.39
71 0.4
72 0.45
73 0.44
74 0.46
75 0.52
76 0.55
77 0.59
78 0.57
79 0.62
80 0.64
81 0.6
82 0.6
83 0.6
84 0.61
85 0.58
86 0.62
87 0.64
88 0.65
89 0.72
90 0.77
91 0.79
92 0.78
93 0.78
94 0.79
95 0.76
96 0.72
97 0.72
98 0.69
99 0.69
100 0.68
101 0.65
102 0.61
103 0.65
104 0.66
105 0.65
106 0.68
107 0.7
108 0.73
109 0.79
110 0.81
111 0.79
112 0.8
113 0.76
114 0.68