Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R4XE81

Protein Details
Accession R4XE81    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTLKRRNNGRNKHGRGHTKPVRCBasic
88-114SREGRRVRTPPPRVRFNKDGKKINPNVHydrophilic
NLS Segment(s)
PositionSequence
87-109RSREGRRVRTPPPRVRFNKDGKK
Subcellular Location(s) mito_nucl 12, nucl 11.5, mito 11.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTLKRRNNGRNKHGRGHTKPVRCSNCSRCVPKDKAIKRFTVRNMVESAAIRDISEASVYTEYALPKLYNKLHYCISCAIHSKVVRVRSREGRRVRTPPPRVRFNKDGKKINPNVAARAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.82
3 0.82
4 0.81
5 0.78
6 0.79
7 0.8
8 0.78
9 0.72
10 0.74
11 0.71
12 0.72
13 0.71
14 0.69
15 0.66
16 0.68
17 0.69
18 0.68
19 0.7
20 0.68
21 0.7
22 0.67
23 0.67
24 0.62
25 0.64
26 0.6
27 0.6
28 0.53
29 0.46
30 0.44
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.07
41 0.07
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.08
48 0.08
49 0.08
50 0.08
51 0.07
52 0.08
53 0.13
54 0.15
55 0.2
56 0.22
57 0.24
58 0.28
59 0.28
60 0.3
61 0.29
62 0.28
63 0.24
64 0.27
65 0.25
66 0.27
67 0.27
68 0.29
69 0.3
70 0.36
71 0.38
72 0.38
73 0.43
74 0.48
75 0.56
76 0.61
77 0.66
78 0.66
79 0.7
80 0.73
81 0.76
82 0.76
83 0.78
84 0.79
85 0.78
86 0.8
87 0.79
88 0.8
89 0.8
90 0.81
91 0.81
92 0.8
93 0.82
94 0.78
95 0.81
96 0.78
97 0.78
98 0.76
99 0.68